BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0467 (546 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1980|AAF58184.1| 518|Drosophila melanogaster CG17453-P... 29 5.4 BT022757-1|AAY55173.1| 1257|Drosophila melanogaster LD10349p pro... 28 7.2 AY060994-1|AAL28542.1| 623|Drosophila melanogaster HL01216p pro... 28 7.2 AE014134-2292|AAF53254.1| 1257|Drosophila melanogaster CG16974-P... 28 7.2 >AE013599-1980|AAF58184.1| 518|Drosophila melanogaster CG17453-PA protein. Length = 518 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +1 Query: 52 SFVLLLTFLRSPKKGLSYFFKMVTLLA--NETNRRENVTYLVLFLPV 186 +F +L R+PK+ YF K++T + ET+ + YL L + V Sbjct: 240 NFCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLLIDV 286 >BT022757-1|AAY55173.1| 1257|Drosophila melanogaster LD10349p protein. Length = 1257 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 395 IHIYSAIDNG*FICFIINSNGKSCDLFNLVASTVFFYSFTFKLFIF 532 +H S ID+G + C+ N GK+ L + FY +F Sbjct: 738 VHNISRIDSGLYTCYAFNVMGKASAGLRLYIDPIVFYRVKIGSILF 783 >AY060994-1|AAL28542.1| 623|Drosophila melanogaster HL01216p protein. Length = 623 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 395 IHIYSAIDNG*FICFIINSNGKSCDLFNLVASTVFFYSFTFKLFIF 532 +H S ID+G + C+ N GK+ L + FY +F Sbjct: 460 VHNISRIDSGLYTCYAFNVMGKASAGLRLYIDPIVFYRVKIGSILF 505 >AE014134-2292|AAF53254.1| 1257|Drosophila melanogaster CG16974-PA protein. Length = 1257 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 395 IHIYSAIDNG*FICFIINSNGKSCDLFNLVASTVFFYSFTFKLFIF 532 +H S ID+G + C+ N GK+ L + FY +F Sbjct: 738 VHNISRIDSGLYTCYAFNVMGKASAGLRLYIDPIVFYRVKIGSILF 783 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,410,660 Number of Sequences: 53049 Number of extensions: 413470 Number of successful extensions: 758 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2069139900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -