BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0467 (546 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55930.1 68418.m06976 oligopeptide transporter OPT family pro... 28 3.5 At1g63110.1 68414.m07130 cell division cycle protein-related con... 24 5.4 At1g63110.3 68414.m07131 cell division cycle protein-related con... 24 5.5 At1g63110.2 68414.m07132 cell division cycle protein-related con... 24 5.5 >At5g55930.1 68418.m06976 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}, oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 755 Score = 28.3 bits (60), Expect = 3.5 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 203 TFQQYTLVTLFTCII*AFVNIFF 271 TF+ +TL LF+CI+ AFVN FF Sbjct: 55 TFRTWTL-GLFSCILLAFVNQFF 76 >At1g63110.1 68414.m07130 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 469 Score = 24.2 bits (50), Expect(2) = 5.4 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 381 ILWYIYIYIAQSIMVNLYASLLIVMERVVIFLI 479 +LW +Y+ I ++ +N Y L + +R F++ Sbjct: 271 LLWSLYVLILCALSLNKYGGLEEMFKRTYGFIL 303 Score = 21.8 bits (44), Expect(2) = 5.4 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +3 Query: 489 QRFFSILLHLSYLFLVI 539 + FF I+LH++ LF+++ Sbjct: 327 RNFFLIVLHVNILFMLL 343 >At1g63110.3 68414.m07131 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 407 Score = 24.2 bits (50), Expect(2) = 5.5 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 381 ILWYIYIYIAQSIMVNLYASLLIVMERVVIFLI 479 +LW +Y+ I ++ +N Y L + +R F++ Sbjct: 209 LLWSLYVLILCALSLNKYGGLEEMFKRTYGFIL 241 Score = 21.8 bits (44), Expect(2) = 5.5 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +3 Query: 489 QRFFSILLHLSYLFLVI 539 + FF I+LH++ LF+++ Sbjct: 265 RNFFLIVLHVNILFMLL 281 >At1g63110.2 68414.m07132 cell division cycle protein-related contains 9 transmembrane domains; similar to PIG-U (GI:27372215) [Rattus norvegicus]; similar to Cell division cycle protein 91-like 1 (CDC91-like 1 protein) (PIG-U) (Swiss-Prot:Q9H490) [Homo sapiens] Length = 397 Score = 24.2 bits (50), Expect(2) = 5.5 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +3 Query: 381 ILWYIYIYIAQSIMVNLYASLLIVMERVVIFLI 479 +LW +Y+ I ++ +N Y L + +R F++ Sbjct: 199 LLWSLYVLILCALSLNKYGGLEEMFKRTYGFIL 231 Score = 21.8 bits (44), Expect(2) = 5.5 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +3 Query: 489 QRFFSILLHLSYLFLVI 539 + FF I+LH++ LF+++ Sbjct: 255 RNFFLIVLHVNILFMLL 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,680,470 Number of Sequences: 28952 Number of extensions: 207993 Number of successful extensions: 390 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -