BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0466 (578 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M86917-1|AAA59973.1| 807|Homo sapiens oxysterol-binding protein... 29 9.0 BC063121-1|AAH63121.1| 420|Homo sapiens OSBP protein protein. 29 9.0 BC011581-1|AAH11581.1| 807|Homo sapiens oxysterol binding prote... 29 9.0 AF185705-1|AAG28373.1| 807|Homo sapiens oxysterol binding prote... 29 9.0 AF185696-1|AAG17011.1| 807|Homo sapiens oxysterol-binding prote... 29 9.0 >M86917-1|AAA59973.1| 807|Homo sapiens oxysterol-binding protein protein. Length = 807 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 76 WQSTTVLVTGTESGARPS--FITTGRWSESNSETTSIECKRRVT 201 W+S T T+S RP + GRW E+N+E +E K+R++ Sbjct: 706 WESGTA---PTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLS 746 >BC063121-1|AAH63121.1| 420|Homo sapiens OSBP protein protein. Length = 420 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 76 WQSTTVLVTGTESGARPS--FITTGRWSESNSETTSIECKRRVT 201 W+S T T+S RP + GRW E+N+E +E K+R++ Sbjct: 319 WESGTA---PTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLS 359 >BC011581-1|AAH11581.1| 807|Homo sapiens oxysterol binding protein protein. Length = 807 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 76 WQSTTVLVTGTESGARPS--FITTGRWSESNSETTSIECKRRVT 201 W+S T T+S RP + GRW E+N+E +E K+R++ Sbjct: 706 WESGTA---PTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLS 746 >AF185705-1|AAG28373.1| 807|Homo sapiens oxysterol binding protein 1 protein. Length = 807 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 76 WQSTTVLVTGTESGARPS--FITTGRWSESNSETTSIECKRRVT 201 W+S T T+S RP + GRW E+N+E +E K+R++ Sbjct: 706 WESGTA---PTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLS 746 >AF185696-1|AAG17011.1| 807|Homo sapiens oxysterol-binding protein 1 protein. Length = 807 Score = 29.5 bits (63), Expect = 9.0 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 76 WQSTTVLVTGTESGARPS--FITTGRWSESNSETTSIECKRRVT 201 W+S T T+S RP + GRW E+N+E +E K+R++ Sbjct: 706 WESGTA---PTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLS 746 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,001,638 Number of Sequences: 237096 Number of extensions: 1634763 Number of successful extensions: 7111 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7092 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5985693436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -