BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0463 (586 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.3 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 22 4.4 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 22 4.4 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 7.7 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 328 HHELF*MTRINSDFFQHNLIIFF 396 HH L + R+ ++ F H L++ F Sbjct: 858 HHHLSKLIRLFNEIFGHGLLLMF 880 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 460 GNGNHSPSGGP 428 G+GN+ P GGP Sbjct: 530 GSGNNQPPGGP 540 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 46 VFFFFFLMNYIGGVFCVAYQYSNFCFVTKLNLLFICFNLKI 168 VF + + +G V AY FC + + L F+ +NL + Sbjct: 151 VFLAYVWICEMGVVTLQAYTLHLFCVLYVVLLHFLTYNLSL 191 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 46 VFFFFFLMNYIGGVFCVAYQYSNFCFVTKLNLLFICFNLKI 168 VF + + +G V AY FC + + L F+ +NL + Sbjct: 151 VFLAYVWICEMGVVTLQAYTLHLFCVLYVVLLHFLTYNLSL 191 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 294 YGSWNMFLVYKLEFICFIKVYFNLS 220 YGS NM + + F+ +FN+S Sbjct: 52 YGSMNMTVAITDKIANFMLTFFNVS 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,598 Number of Sequences: 336 Number of extensions: 3260 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -