BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0463 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16273| Best HMM Match : SWIM (HMM E-Value=0.02) 28 4.9 SB_34880| Best HMM Match : Methuselah_N (HMM E-Value=9.6) 28 4.9 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_16273| Best HMM Match : SWIM (HMM E-Value=0.02) Length = 817 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 224 CQKYTVTIKTNNDVDS*NRIFKLKQINKRFN 132 C+ + V + TNN ++ N +FK + K N Sbjct: 179 CESFIVGVNTNNGLERQNHVFKCSYLQKHKN 209 >SB_34880| Best HMM Match : Methuselah_N (HMM E-Value=9.6) Length = 343 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 224 CQKYTVTIKTNNDVDS*NRIFKLKQINKRFN 132 C+ + V + TNN ++ N +FK + K N Sbjct: 292 CESFIVGVNTNNGLERQNHVFKCSYLQKHKN 322 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 402 IAHVGRQAYGPPDGE 446 + HVGRQ +G PDG+ Sbjct: 13 VVHVGRQVHGAPDGD 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,081,258 Number of Sequences: 59808 Number of extensions: 322123 Number of successful extensions: 580 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -