BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0463 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 24 3.2 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 23 9.6 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -1 Query: 511 LTVASGLALHLVLLKSMGNGNHSPSGGPYACLPTWAIKKK 392 L V+ L L LVL ++ G +PSG Y +P ++++ Sbjct: 5 LLVSCLLLLQLVLTQADGGSFLAPSGSNYCPIPLEVLEQE 44 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 281 ICFSYINWSLYVLLRCILICQKYTVTIKTNND 186 ICF+ +NW + L+R +C + T++ D Sbjct: 541 ICFNILNWCM--LVRSSNVCPYVSSTMEKTLD 570 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,235 Number of Sequences: 2352 Number of extensions: 11889 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -