BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0462 (636 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043701-7|AAK18972.1| 498|Caenorhabditis elegans Hypothetical ... 101 3e-22 Z69902-10|CAI59119.1| 4053|Caenorhabditis elegans Hypothetical p... 28 4.9 Z69902-9|CAH10779.1| 4061|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z69902-8|CAA93765.2| 4064|Caenorhabditis elegans Hypothetical pr... 28 4.9 AY551966-1|AAS65430.1| 4064|Caenorhabditis elegans TRR-1 protein. 28 4.9 >AF043701-7|AAK18972.1| 498|Caenorhabditis elegans Hypothetical protein K12C11.1 protein. Length = 498 Score = 101 bits (243), Expect = 3e-22 Identities = 56/119 (47%), Positives = 72/119 (60%), Gaps = 6/119 (5%) Frame = +3 Query: 294 TWSMGPGTLEVPLSLFATNRRRLANKLKS----GQIVVLQGGEDVNHYDTDVQYV-FRQE 458 T+ + T +VP+ LF NR RL + LKS +V+LQGG + N Y+TD + FRQE Sbjct: 2 TFQLSEKTFKVPVDLFTENRHRLVDALKSKVPANSVVLLQGGVEKNRYNTDAADLPFRQE 61 Query: 459 AYFTWVCGVREPGCYFALDV-STGKSYLFVPRLPEEYEVWMGKLHACSDFKNIYAVDEV 632 +YF W GV E Y A+DV S GK+ LF PRL Y +W GK++ FK YAVDEV Sbjct: 62 SYFFWTFGVNESEFYGAIDVRSGGKTTLFAPRLDPSYAIWDGKINNEQFFKEKYAVDEV 120 >Z69902-10|CAI59119.1| 4053|Caenorhabditis elegans Hypothetical protein C47D12.1c protein. Length = 4053 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 75 FFVYFQLNIYIFIMFLTIASC 13 F Y +LNIY + +F+ IASC Sbjct: 1797 FLRYLRLNIYDYDLFIVIASC 1817 >Z69902-9|CAH10779.1| 4061|Caenorhabditis elegans Hypothetical protein C47D12.1b protein. Length = 4061 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 75 FFVYFQLNIYIFIMFLTIASC 13 F Y +LNIY + +F+ IASC Sbjct: 1803 FLRYLRLNIYDYDLFIVIASC 1823 >Z69902-8|CAA93765.2| 4064|Caenorhabditis elegans Hypothetical protein C47D12.1a protein. Length = 4064 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 75 FFVYFQLNIYIFIMFLTIASC 13 F Y +LNIY + +F+ IASC Sbjct: 1803 FLRYLRLNIYDYDLFIVIASC 1823 >AY551966-1|AAS65430.1| 4064|Caenorhabditis elegans TRR-1 protein. Length = 4064 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 75 FFVYFQLNIYIFIMFLTIASC 13 F Y +LNIY + +F+ IASC Sbjct: 1803 FLRYLRLNIYDYDLFIVIASC 1823 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,222,704 Number of Sequences: 27780 Number of extensions: 294620 Number of successful extensions: 598 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -