BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0461 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) 71 7e-13 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 69 2e-12 SB_52314| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) 61 6e-10 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) 56 2e-08 SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) 56 3e-08 SB_22047| Best HMM Match : Mito_carr (HMM E-Value=0) 52 3e-07 SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) 51 6e-07 SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) 51 8e-07 SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) 50 2e-06 SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) 49 2e-06 SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) 49 3e-06 SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) 45 4e-05 SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) 45 5e-05 SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_21443| Best HMM Match : Mito_carr (HMM E-Value=2.8e-26) 44 9e-05 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 43 2e-04 SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) 42 3e-04 SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) 42 4e-04 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 41 7e-04 SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) 41 9e-04 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 41 9e-04 SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.002 SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.002 SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) 40 0.002 SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.002 SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 37 0.014 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) 32 0.40 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 0.53 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 31 0.53 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 0.70 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 31 0.93 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 30 1.2 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 30 1.6 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26289| Best HMM Match : TLD (HMM E-Value=0.08) 30 1.6 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 29 2.1 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 2.1 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 29 2.1 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 29 2.8 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 29 3.8 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 3.8 SB_25855| Best HMM Match : OATP (HMM E-Value=1.2e-06) 29 3.8 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 29 3.8 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 3.8 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_24958| Best HMM Match : S-methyl_trans (HMM E-Value=1.6e-40) 29 3.8 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 3.8 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 28 5.0 SB_1082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 28 5.0 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 5.0 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 28 6.6 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 27 8.7 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 27 8.7 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_38431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 27 8.7 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) 27 8.7 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 83.4 bits (197), Expect = 1e-16 Identities = 45/132 (34%), Positives = 77/132 (58%), Gaps = 1/132 (0%) Frame = +1 Query: 181 KYEHLVAGISGGVT-STLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVR 357 +++ L +G+ GV+ + +++ P++ IK++F ++D +T P+Y G S TI+K EG Sbjct: 136 QFQTLASGLGAGVSEAVVVVCPMETIKVKF-IHD-QTQPNPKYKGFFSGVRTILKTEGFF 193 Query: 358 GLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMT 537 G+Y+G+T V GS F Y+ +K+W+QGG++ +G L AG S+ Sbjct: 194 GVYKGLTATVIKQGSNQMIRFFVYSNLKSWLQGGDSSKDIGAVKTFLIGGVAGAASVFGN 253 Query: 538 NPIWVVKTRLCL 573 P+ VVKTR+ L Sbjct: 254 TPVDVVKTRMQL 265 Score = 36.3 bits (80), Expect = 0.019 Identities = 25/92 (27%), Positives = 41/92 (44%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L GI+GG+ P + +K + +++ A P Y G VK GV GLYRG Sbjct: 45 LAGGIAGGL-EICCTFPTEYVKTQLQLDE--KAAKPIYRGPIDCVKKTVKGHGVLGLYRG 101 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKTWIQGGNAR 468 ++ ++GS F + +K + N + Sbjct: 102 LSSLLYGSVPKASVRFAVFEYLKNKMADENGK 133 >SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 306 Score = 70.9 bits (166), Expect = 7e-13 Identities = 46/132 (34%), Positives = 68/132 (51%), Gaps = 1/132 (0%) Frame = +1 Query: 184 YEHLVAGISGGVTSTLILHPLDLIKIRF-AVNDGRTATVPRYDGLSSAFVTIVKKEGVRG 360 ++ +VAG+S GV + I P DL+KIRF AV G T+P Y + AF I KKEG G Sbjct: 115 WKKIVAGVSSGVIGSAIATPTDLVKIRFQAVKIGE--TIP-YKNMFHAFYKIAKKEGFLG 171 Query: 361 LYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTN 540 L+ G+ P V + G Y+ K + G LH+ +A AG ++ + + Sbjct: 172 LWTGMKPTVKRAACISGTQIPTYDHTKHLLLNAELMRE-GVALHLASALVAGFVATCVAS 230 Query: 541 PIWVVKTRLCLQ 576 P+ +V+TR Q Sbjct: 231 PVDIVRTRFMTQ 242 Score = 44.4 bits (100), Expect = 7e-05 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPR-YDGLSSAFVTIVKKEGVRGLY 366 HL + + G +T + P+D+++ RF T P Y G V+ EG+ LY Sbjct: 214 HLASALVAGFVATCVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALY 273 Query: 367 RGVTPNVWGSGSAWGFYFLFYNAIKTW 447 +G PN +G F Y ++ + Sbjct: 274 KGFFPNWTRTGLDTIIIFFVYERLRRY 300 Score = 36.7 bits (81), Expect = 0.014 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 9/122 (7%) Frame = +1 Query: 226 TLILHPLDLIKIRFAVNDG-----RTATVPR---YDGL-SSAFVTIVKKEGVRGLYRGVT 378 T + +P++++KIR +++ + + R Y GL + + ++EGVRGLYRG+ Sbjct: 21 TSVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYREEGVRGLYRGIF 80 Query: 379 PNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVK 558 P + Y IK + G T ++A +GV+ + P +VK Sbjct: 81 PALLRQAIYSSTRLGAYEPIKN-LLGATDSTSAALWKKIVAGVSSGVIGSAIATPTDLVK 139 Query: 559 TR 564 R Sbjct: 140 IR 141 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 69.3 bits (162), Expect = 2e-12 Identities = 36/124 (29%), Positives = 68/124 (54%) Frame = +1 Query: 196 VAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGV 375 V+G + GV +T HPLD+++ R V D T ++ Y G+ SA I +EG+RGLY+G+ Sbjct: 33 VSGATAGVVATASTHPLDVVRARLTVQDMSTRSISNYTGIVSALRRIHIEEGIRGLYKGL 92 Query: 376 TPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVV 555 P++ G Y+ +K ++ ++ G ++ A AG+++ + +P+ VV Sbjct: 93 VPSLVSIAPFLGVQQSVYDIMK--LRALDSAFAANSGTFLVCGAIAGMIAQTVVHPLDVV 150 Query: 556 KTRL 567 + ++ Sbjct: 151 RRQM 154 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/62 (30%), Positives = 36/62 (58%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 LV G G+ + ++HPLD+++ + V+ GR+ ++ + SA + K+ G R +Y G Sbjct: 130 LVCGAIAGMIAQTVVHPLDVVRRQMQVDRGRSGSITQTS--LSALKILWKQGGPRRIYAG 187 Query: 373 VT 378 +T Sbjct: 188 LT 189 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 460 NARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVKTRLCLQ 576 N + P P ++ A AGV++ T+P+ VV+ RL +Q Sbjct: 21 NDKNPHQPLWRFVSGATAGVVATASTHPLDVVRARLTVQ 59 >SB_52314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 64.1 bits (149), Expect = 8e-11 Identities = 42/148 (28%), Positives = 72/148 (48%), Gaps = 19/148 (12%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGR----------------TATVPR---YDGL 315 LVAG GG T ++ PLD+I+ R + R T++V + + G+ Sbjct: 730 LVAGGLGGSTGVILTCPLDVIQTRLQSSAFRLQRISQLGLNMAGIEATSSVSKPTNFYGV 789 Query: 316 SSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHM 495 S I + EG R L++G+ PN+ + YF Y +K W+ G +++ Sbjct: 790 FSYGRYIARTEGARSLFKGLCPNLLAVTPSRAIYFTTYQKLKEWLNNGGILAANSSMVYL 849 Query: 496 LAAAEAGVLSLVMTNPIWVVKTRLCLQY 579 ++ A A +++ +TNP+W +KTRL L + Sbjct: 850 VSGASAQIVNSTITNPLWFLKTRLQLDF 877 Score = 41.9 bits (94), Expect = 4e-04 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 5/137 (3%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVND--GRTATVPRYDGLSSAFVTIVKKEGVRGL 363 +LV+G S + ++ I +PL +K R ++ GR + R + A+ T EG+R Sbjct: 848 YLVSGASAQIVNSTITNPLWFLKTRLQLDFKCGREVKLARV--VRQAYAT----EGIRAF 901 Query: 364 YRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNART---PLGPGLHMLAAAEAGVLSLVM 534 Y+G++ + GS G +F Y +K + +T LAA A V+S Sbjct: 902 YKGLSASYLGSIEV-GLHFAIYENLKQQLLRSQNKTNDHQFTLAECTLAAGSAKVVSTGP 960 Query: 535 TNPIWVVKTRLCLQYSE 585 P VV+TRL Q S+ Sbjct: 961 CYPYEVVRTRLRQQESD 977 >SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 1024 Score = 61.3 bits (142), Expect = 6e-10 Identities = 31/99 (31%), Positives = 55/99 (55%), Gaps = 1/99 (1%) Frame = +1 Query: 283 RTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWI-QGG 459 RT TV ++ G+ +VK EG++ L++G+ + G + YF Y+ +K + + G Sbjct: 767 RTTTVNKFSGIVPYARYMVKNEGIQSLFKGLGTTLLGVTPSRAIYFAIYSKLKDMLNKSG 826 Query: 460 NARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVKTRLCLQ 576 G +HM ++A A ++ +TNP+W +KTRL L+ Sbjct: 827 ALGKADGSLIHMTSSAIAAFINHTVTNPLWFIKTRLQLE 865 Score = 33.5 bits (73), Expect = 0.13 Identities = 34/134 (25%), Positives = 56/134 (41%), Gaps = 2/134 (1%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYR 369 H+ + + + +PL IK R + + + +S A+ K EG+R YR Sbjct: 837 HMTSSAIAAFINHTVTNPLWFIKTRLQLENQGGTRASAFKIVSMAY----KAEGIRAFYR 892 Query: 370 GVTPNVWGSGSAWGFYFLFYNAIKTWI--QGGNARTPLGPGLHMLAAAEAGVLSLVMTNP 543 G+T + G S +F Y +K + +R MLAA + ++ + P Sbjct: 893 GLTASYVGI-SETVVHFTIYERLKAELLKLHYKSRRDFHVVECMLAAGISKCIATSLCYP 951 Query: 544 IWVVKTRLCLQYSE 585 V +TRL Q SE Sbjct: 952 HEVARTRLRQQESE 965 Score = 32.3 bits (70), Expect = 0.30 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +1 Query: 175 HIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGV 354 H+ L AGIS + ++L +P ++ + R + +Y T++++EG Sbjct: 930 HVVECMLAAGISKCIATSLC-YPHEVARTRLRQQESEFLGRQKYRSFFQTLGTVLREEGW 988 Query: 355 RGLYRGVTPNV 387 RGLY G+ +V Sbjct: 989 RGLYGGLGTHV 999 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 59.3 bits (137), Expect = 2e-09 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 2/136 (1%) Frame = +1 Query: 187 EHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLY 366 + L+AG GV S ++PL+++K R A+ +T +Y GL A I +KEG+R Y Sbjct: 232 DRLLAGSMAGVASQTSIYPLEVLKTRLAIR--KTG---QYRGLLHAASVIYQKEGIRSFY 286 Query: 367 RGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAA--AEAGVLSLVMTN 540 RG+ P++ G G Y +K + + PG+ +L A + + + Sbjct: 287 RGLFPSLLGIIPYAGIDLAVYETLKNFYLNYHKNQSADPGVLVLLACGTASSTCGQLASY 346 Query: 541 PIWVVKTRLCLQYSEE 588 P+ +V+TRL Q E+ Sbjct: 347 PLSLVRTRLQAQAREK 362 Score = 49.2 bits (112), Expect = 2e-06 Identities = 38/130 (29%), Positives = 64/130 (49%) Frame = +1 Query: 202 GISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTP 381 G GV+ T PLD +K+ V + ++ R+ G+ S F ++++ G++ L+RG Sbjct: 144 GALAGVSRTATA-PLDRLKVLLQV---QASSTNRF-GIVSGFKMMLREGGIKSLWRGNGA 198 Query: 382 NVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVKT 561 NV G F Y K + G+ LG +LA + AGV S P+ V+KT Sbjct: 199 NVIKIAPESGIKFFAYEKAKKLV--GSDTKALGVTDRLLAGSMAGVASQTSIYPLEVLKT 256 Query: 562 RLCLQYSEEH 591 RL ++ + ++ Sbjct: 257 RLAIRKTGQY 266 Score = 37.9 bits (84), Expect = 0.006 Identities = 21/83 (25%), Positives = 36/83 (43%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L G + L +PL L++ R R + D + S I+ ++G +GLYRG Sbjct: 331 LACGTASSTCGQLASYPLSLVRTRLQAQ-AREKGGGQGDNMVSVLRKIITEDGFKGLYRG 389 Query: 373 VTPNVWGSGSAWGFYFLFYNAIK 441 + PN A ++ Y ++ Sbjct: 390 LAPNFLKVAPAVSISYVVYENLR 412 >SB_26166| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 612 Score = 56.0 bits (129), Expect = 2e-08 Identities = 38/132 (28%), Positives = 60/132 (45%) Frame = +1 Query: 172 SHIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEG 351 S + + +V G + + + + P+ ++K R+ + Y + A V+I EG Sbjct: 426 SELLRKSIVLGATARTIAGVCMMPVTVVKTRYESGNFN------YTSMRQALVSIWTNEG 479 Query: 352 VRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLV 531 RGLY G+ V G Y +FY IK +G L G + + AG ++ V Sbjct: 480 GRGLYSGLVATVARDAPFSGLYLMFYTQIKRRAKGLLQVGDLTSGQNFICGIMAGAMASV 539 Query: 532 MTNPIWVVKTRL 567 +T P VVKTRL Sbjct: 540 VTQPADVVKTRL 551 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 4/81 (4%) Frame = +1 Query: 187 EHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLY 366 ++ + GI G ++++ P D++K R +N Y +A V I++ G+ GL+ Sbjct: 525 QNFICGIMAGAMASVVTQPADVVKTRLQMNPYM------YPSNRAAVVAIIEAGGIEGLF 578 Query: 367 RGVTP----NVWGSGSAWGFY 417 RG+ P S AW Y Sbjct: 579 RGLVPRTVRRTLMSAMAWTIY 599 >SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 276 Score = 55.6 bits (128), Expect = 3e-08 Identities = 35/124 (28%), Positives = 63/124 (50%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 + A I+ G+ + + P +++KIRF + GR + G + I + EG++GL++G Sbjct: 128 IAASITTGIMAVSVAQPTEVVKIRFQADAGRYTS-----GTMGTYAEIARNEGMKGLWKG 182 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWV 552 V PN+ + + Y++IK P LH ++A AG ++ + +P+ V Sbjct: 183 VFPNMARLCTVNVTELVVYDSIKGLFLRKQWMADEFP-LHFVSAFGAGFVTTCVASPVDV 241 Query: 553 VKTR 564 VKTR Sbjct: 242 VKTR 245 Score = 36.7 bits (81), Expect = 0.014 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 12/134 (8%) Frame = +1 Query: 199 AGISGGVTSTLILHPLDLIKIRFAVNDG-----------RTATVPRYDGLSSAFVTIVKK 345 AGI+ + + P+D K+R + RT Y G+ VT+ K Sbjct: 21 AGIAASIAEAATI-PIDTAKVRLQIQGESAVMASIAQGVRTTHDAHYRGMLGTMVTLFKT 79 Query: 346 EGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAA-EAGVL 522 EG++ +Y+G+ P + Y+ +K + + P L +AA+ G++ Sbjct: 80 EGMKTMYKGLIPGIHRQLCFASIRIGLYDQVKAMYGDTDVQNP--KILKKIAASITTGIM 137 Query: 523 SLVMTNPIWVVKTR 564 ++ + P VVK R Sbjct: 138 AVSVAQPTEVVKIR 151 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYR 369 H V+ G +T + P+D++K R+ + T G+ A V + K G+ Y+ Sbjct: 221 HFVSAFGAGFVTTCVASPVDVVKTRYMNSPANTYK----SGIDCA-VQLFKHNGIFAYYK 275 Query: 370 G 372 G Sbjct: 276 G 276 >SB_22047| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 421 Score = 52.4 bits (120), Expect = 3e-07 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 2/136 (1%) Frame = +1 Query: 166 LLSHIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVP--RYDGLSSAFVTIV 339 +L+++ + +++G+S G I P DL+K++ + R + P G AF IV Sbjct: 126 MLTYVCRKSVISGMSAGALGQFISSPTDLVKVQMQMEGRRLSFYPISSVRGTFHAFRNIV 185 Query: 340 KKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGV 519 K G RGL++G PNV + Y+ +K + + R +H +++ +G+ Sbjct: 186 DKYGFRGLWKGWLPNVQRAALVNMGDLTTYDTVKHNLL-KHTRLEDNWIVHSMSSVCSGL 244 Query: 520 LSLVMTNPIWVVKTRL 567 ++ ++ P V+KTR+ Sbjct: 245 VAATISTPADVIKTRI 260 Score = 34.3 bits (75), Expect = 0.076 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 5/77 (6%) Frame = +1 Query: 166 LLSHIKYE-----HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFV 330 LL H + E H ++ + G+ + I P D+IK R N Y G F+ Sbjct: 290 LLKHTRLEDNWIVHSMSSVCSGLVAATISTPADVIKTRIMNNPSG------YQGAVECFM 343 Query: 331 TIVKKEGVRGLYRGVTP 381 V +EG+ LY+G P Sbjct: 344 LAVHREGLLSLYKGWLP 360 >SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 375 Score = 51.2 bits (117), Expect = 6e-07 Identities = 32/131 (24%), Positives = 60/131 (45%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 ++AG S + + + ++P ++IK R V + Y G+ A TI+++EG+ LY+G Sbjct: 156 MLAGTSSTLIAMVTVYPCEVIKTRLTVQHVNKSNA-HYKGMRHALKTILREEGILALYKG 214 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWV 552 VTP+ G G FL Y + + P + AG + +++P Sbjct: 215 VTPSFLGLFPFAGGSFLAYQILDK-VDSTRTEPSATPICMFVNGCVAGAFAHTLSHPFDT 273 Query: 553 VKTRLCLQYSE 585 ++ ++ L E Sbjct: 274 IRKKMQLTGKE 284 >SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 274 Score = 50.8 bits (116), Expect = 8e-07 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 1/124 (0%) Frame = +1 Query: 199 AGISGGVTSTLILHPLDLIKIRFAVN-DGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGV 375 AG G+ ++ P+DL+KI+ + + + +T Y G V + + G+ G ++G Sbjct: 39 AGSVAGLAQVPLIAPVDLVKIKLQMQTEAKRSTRSVYRGPVDCLVKLYRSRGLAGCFQGN 98 Query: 376 TPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVV 555 T + YF Y + W N G +++A AGV+S T P V+ Sbjct: 99 TVTAVRDIPGFAVYFGVYELLCDWFS--NLFGSRGVATYLMAGGFAGVVSWASTFPFDVI 156 Query: 556 KTRL 567 K+R+ Sbjct: 157 KSRI 160 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYR 369 +L+AG GV S P D+IK R DG RY G+ + K+EG+ R Sbjct: 135 YLMAGGFAGVVSWASTFPFDVIKSRIQA-DGNLGKF-RYKGMMDCALQSYKEEGMIVFTR 192 Query: 370 GVTPNV 387 G+ P + Sbjct: 193 GIWPTL 198 >SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 328 Score = 49.6 bits (113), Expect = 2e-06 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 2/126 (1%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L AG+ GV ++ +L PLD +K + + Y G I ++ GVRG+Y+G Sbjct: 141 LAAGMIAGVATSFVLTPLDRVKCILQIEKAFGGS--SYGGPVDCLRRIYREAGVRGVYKG 198 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKTWIQG--GNARTPLGPGLHMLAAAEAGVLSLVMTNPI 546 ++ WG F I G + +GPG +++ A AG+ P Sbjct: 199 ISVTAMRDIPGWGAMFFTNELCHRAITGEKNHLTRHIGPGGVLVSGAIAGMAYWTAGLPA 258 Query: 547 WVVKTR 564 V+KTR Sbjct: 259 DVLKTR 264 Score = 40.3 bits (90), Expect = 0.001 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 1/116 (0%) Frame = +1 Query: 196 VAGISGGVTSTLILHPLDLIKIRF-AVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 +AG + G + L+ PLD IK+R A+ + Y F I++ EGV L+RG Sbjct: 43 IAGSAAGAAANLVGFPLDTIKVRLQAMPLPKPGEPWMYKNSFDCFFKIIRNEGVYYLFRG 102 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTN 540 VT + S F + +K++ + P+ +L + AG+++ V T+ Sbjct: 103 VTVPILNSIPNTTVLFSCVSFVKSY------KLPVSKDPELLRSLAAGMIAGVATS 152 >SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) Length = 868 Score = 49.2 bits (112), Expect = 2e-06 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 4/138 (2%) Frame = +1 Query: 187 EHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTAT-VP-RYDGLSSAFVTIVKKEGVRG 360 E+ G G+ I P+DL K + V R + P +Y + A TI + G+RG Sbjct: 203 EYYACGAGTGLVVAFIEGPIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRG 262 Query: 361 LYRGVTPNVWGSGSAWGFYFLFYNAIKTWI--QGGNARTPLGPGLHMLAAAEAGVLSLVM 534 Y+G++ + + A GF+F FY K + +GG GL + + A G + Sbjct: 263 CYQGLSATLVRNIPANGFFFGFYEFTKNLLTPEGGTVNDVSPLGL-LTSGAMGGFFYWFL 321 Query: 535 TNPIWVVKTRLCLQYSEE 588 T P +VK+ + +S++ Sbjct: 322 TYPTDLVKSSMMADHSDK 339 >SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 49.2 bits (112), Expect = 2e-06 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 5/71 (7%) Frame = +1 Query: 187 EHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTAT-----VPRYDGLSSAFVTIVKKEG 351 E L G G+ S ++ P D+IK R V A V +YDG+ F TI+K+EG Sbjct: 31 ESLTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCFRTILKEEG 90 Query: 352 VRGLYRGVTPN 384 GL++G+ P+ Sbjct: 91 AMGLFKGLAPS 101 >SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) Length = 95 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/75 (33%), Positives = 39/75 (52%) Frame = +1 Query: 217 VTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWGS 396 +T+ L+ +PLD+++ R A+ + +Y GL +AF I + EG+R YRG P + G Sbjct: 1 MTAALLTYPLDMVRARLAITQKK-----KYTGLINAFTRIYRDEGMRTFYRGYVPTLIGI 55 Query: 397 GSAWGFYFLFYNAIK 441 G F Y K Sbjct: 56 MPYAGISFFTYETCK 70 >SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 309 Score = 45.2 bits (102), Expect = 4e-05 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 3/81 (3%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRF-AVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLY 366 +L+AG G+ PLDL+K+R A+N + + G F+ V+ EG+RGLY Sbjct: 23 NLIAGSVSGMLGCAAGQPLDLLKVRLQAMNQVKPGETAPFKGAMDCFMKTVRLEGLRGLY 82 Query: 367 RG-VTPNVWGSGS-AWGFYFL 423 +G ++P + + S A FY L Sbjct: 83 KGMLSPLLMATPSTALTFYSL 103 Score = 41.9 bits (94), Expect = 4e-04 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 1/124 (0%) Frame = +1 Query: 199 AGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVT 378 AG+ G + + P + IK V G + + G + I +EGVRG++RG+ Sbjct: 126 AGLFCGFCVSFLFAPAERIKCILQVEAGASGSTQ--SGPYAIVKRIYAEEGVRGIFRGLP 183 Query: 379 PNVWGSGSAWGFYFLFYNAIKTWIQG-GNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVV 555 P + G ++L Y + ++ G +R +G + A AG+ + P+ ++ Sbjct: 184 PTMIRDTFGTGVWYLTYEGLLMLMRSEGTSRDDIGTLQIVSAGGIAGLALWGLMFPVDML 243 Query: 556 KTRL 567 KTR+ Sbjct: 244 KTRV 247 >SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 45.2 bits (102), Expect = 4e-05 Identities = 36/140 (25%), Positives = 65/140 (46%), Gaps = 4/140 (2%) Frame = +1 Query: 178 IKY-EHLVAGISGGVTSTLILHPLDLIKIRFAVND---GRTATVPRYDGLSSAFVTIVKK 345 IK+ +++ +G + G S ++ LD + R A ND G+ +++G+ + + Sbjct: 111 IKFSKNIASGGAAGAMSLFFVYSLDYCRTRLA-NDAKVGKKGGERQFNGMIDVYKKTIAS 169 Query: 346 EGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLS 525 +G+ GLYRG + G GFYF Y+ +K + G +A + L AG+ S Sbjct: 170 DGLVGLYRGFVISCVGIIVYRGFYFGLYDTLKPILLGEDAGVVISFVLGYGVTVSAGLAS 229 Query: 526 LVMTNPIWVVKTRLCLQYSE 585 PI ++ R+ + E Sbjct: 230 Y----PIDTIRRRMMMTSGE 245 Score = 34.3 bits (75), Expect = 0.076 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +1 Query: 196 VAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGV 375 V G V++ L +P+D I+ R + G +Y G + I+KKEG L +G Sbjct: 216 VLGYGVTVSAGLASYPIDTIRRRMMMTSGEAV---KYKGSIDCTIQILKKEGAMSLMKGA 272 Query: 376 TPNV 387 N+ Sbjct: 273 GANI 276 >SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) Length = 233 Score = 44.8 bits (101), Expect = 5e-05 Identities = 36/115 (31%), Positives = 57/115 (49%) Frame = +1 Query: 232 ILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWG 411 +L+P +LIKIR V R T+ Y+G AF +++ EGVRGLY+G + G A Sbjct: 32 LLYPANLIKIRLQVQ--RKTTL--YNGSLDAFTKVIRTEGVRGLYKGYLVSCAGL-FAGQ 86 Query: 412 FYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVKTRLCLQ 576 Y Y +++ N T G LA A ++ +T P+ ++ +L +Q Sbjct: 87 CYITTYELVRSKTAQYN-YTIRG----FLAGGCASIVGQTITVPVDIISQKLMIQ 136 Score = 30.7 bits (66), Expect = 0.93 Identities = 31/136 (22%), Positives = 57/136 (41%), Gaps = 7/136 (5%) Frame = +1 Query: 181 KYEHLVAG-ISGGVTSTL---ILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKE 348 +Y + + G ++GG S + I P+D+I + + G+ + G + Sbjct: 101 QYNYTIRGFLAGGCASIVGQTITVPVDIISQKLMIQ-GQGDRKVKLKGARILIRETFHQH 159 Query: 349 GVRGLYRGVTPNVWG---SGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGV 519 G G Y+G ++ S + W + FY + + L G + AGV Sbjct: 160 GPGGFYKGYFASLMTYAPSSAIWWASYGFYTGVIGNLSADGTHRLLVLGS---SGVLAGV 216 Query: 520 LSLVMTNPIWVVKTRL 567 + +TNP+ V++TRL Sbjct: 217 TAATLTNPLDVIRTRL 232 >SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 44.4 bits (100), Expect = 7e-05 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L+ G G S +PLD+++ R + R Y AF +IVK EG RGLY+G Sbjct: 165 LMCGSLAGAVSQTATYPLDVVRRRMQMKGIRADFA--YKSTLHAFSSIVKLEGFRGLYKG 222 Query: 373 VTPNV 387 + PN+ Sbjct: 223 MWPNI 227 Score = 44.0 bits (99), Expect = 9e-05 Identities = 24/86 (27%), Positives = 43/86 (50%) Frame = +1 Query: 130 MKNPNPSSSKLALLSHIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYD 309 +K P S ++ S+ ++HL+AG G S + PL+ +KI + P++ Sbjct: 17 LKQPEFSDVRIPKTSYKPFKHLLAGGIAGAVSRTSVSPLERVKILLQIQ----VKNPKFK 72 Query: 310 GLSSAFVTIVKKEGVRGLYRGVTPNV 387 G+ + I K+EG+ G ++G NV Sbjct: 73 GVLPTLIQIGKEEGILGYFKGNGTNV 98 >SB_21443| Best HMM Match : Mito_carr (HMM E-Value=2.8e-26) Length = 205 Score = 44.0 bits (99), Expect = 9e-05 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 3/127 (2%) Frame = +1 Query: 205 ISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPN 384 +S G+T T ++ PLDL+K R V+ +Y + + F +K++GVRGL RG P Sbjct: 64 LSCGLTHTAVV-PLDLVKCRIQVDP------KKYGSMVNGFKITLKEDGVRGLARGWAPT 116 Query: 385 VWGSGSAWGFYFLFYNAIKTW---IQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVV 555 G F FY K + G L++ A+A A + + P+ V Sbjct: 117 FIGYSMQGLGKFGFYEVFKIMYGNMLGEEYSYLYRTSLYLAASASAEFFADIALAPMEAV 176 Query: 556 KTRLCLQ 576 K R+ Q Sbjct: 177 KVRIQTQ 183 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/63 (31%), Positives = 36/63 (57%) Frame = +1 Query: 196 VAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGV 375 + G S + + + ++P ++IK R V + Y G+ A TI+++EG+ LY+GV Sbjct: 426 LVGTSSTLIAMVTVYPCEVIKTRLTVQHVNKSNA-HYKGMRHALKTILREEGILALYKGV 484 Query: 376 TPN 384 TP+ Sbjct: 485 TPS 487 >SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) Length = 192 Score = 42.3 bits (95), Expect = 3e-04 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 11/119 (9%) Frame = +1 Query: 148 SSSKLALLSHIKYE-----HLVAGISGGVTSTLILHPLDLIKIRFA---VNDGRTATVPR 303 S +K LLS +E H A + G+ +T+ P+D+ K R + DG+ P Sbjct: 77 SQAKQLLLSTKYFEDNIVCHFGASMISGLATTVASMPVDIAKTRIQNMRIIDGK----PE 132 Query: 304 YDGLSSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWGFYFLF---YNAIKTWIQGGNART 471 Y G IV+ EGV L++G TP + G F+F N + GG + T Sbjct: 133 YKGTMDVLARIVRNEGVFALWKGFTPYYFRIGPHTVLTFIFLEQLNRAANYFYGGTSAT 191 Score = 28.7 bits (61), Expect = 3.8 Identities = 28/123 (22%), Positives = 51/123 (41%), Gaps = 2/123 (1%) Frame = +1 Query: 205 ISGGVTSTLILHPLDLIKIRFAVNDGRTATVPR--YDGLSSAFVTIVKKEGVRGLYRGVT 378 ++ G + + P ++ IR +DGR R Y + +A + K+EGV L+RG Sbjct: 1 MTAGAIGSFVGTPAEISLIRMT-SDGRLPPEQRRGYTNVFNALYRMSKEEGVLTLWRGYI 59 Query: 379 PNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVK 558 P + Y+ K + H A+ +G+ + V + P+ + K Sbjct: 60 PTAVRAMVVNAAQLATYSQAKQLLLSTKYFED-NIVCHFGASMISGLATTVASMPVDIAK 118 Query: 559 TRL 567 TR+ Sbjct: 119 TRI 121 >SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) Length = 302 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/65 (32%), Positives = 35/65 (53%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L AG G+T+++ ++PLD+IK R + + R P Y+G+ I EG+ Y+G Sbjct: 209 LGAGCLAGMTASVAVNPLDVIKTRLQLLN-RPQGEPNYNGIIDCAKKIYSNEGLAAFYKG 267 Query: 373 VTPNV 387 P + Sbjct: 268 AVPRM 272 Score = 29.5 bits (63), Expect = 2.1 Identities = 37/138 (26%), Positives = 59/138 (42%), Gaps = 5/138 (3%) Frame = +1 Query: 175 HIKYEHL--VAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDG--LSSAFVTIVK 342 HI HL +AG + G + P++++KI+ + GR AT + + S+ T Sbjct: 104 HILPLHLEMIAGAAAGCCQVAVTTPMEMLKIQMQMA-GRHATTATANSSLVGSSSSTKAH 162 Query: 343 KEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLGPGLHMLAAA-EAGV 519 G P + F + N + GG + PL ++ L A AG+ Sbjct: 163 ISRSYGTASVAVPRDIPFSCIYFPLFAYLNLKSIDMHGG--KPPL---IYCLGAGCLAGM 217 Query: 520 LSLVMTNPIWVVKTRLCL 573 + V NP+ V+KTRL L Sbjct: 218 TASVAVNPLDVIKTRLQL 235 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 41.1 bits (92), Expect = 7e-04 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 3/130 (2%) Frame = +1 Query: 196 VAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGV 375 +AG V ++P+++IK R + Y G+ ++ K+EG+R YR Sbjct: 2 LAGACATVFHDGAMNPIEVIKQRLQMYGSP------YRGVIHCATSVFKEEGIRAFYRSY 55 Query: 376 TPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPLG---PGLHMLAAAEAGVLSLVMTNPI 546 T + + +F Y + A PLG P H++A A AG ++ +T P+ Sbjct: 56 TTQLSMNIPFQTLHFTVYEYAR------KALNPLGGYDPKTHVIAGATAGAVASAITTPL 109 Query: 547 WVVKTRLCLQ 576 V KT L Q Sbjct: 110 DVAKTLLNTQ 119 Score = 30.7 bits (66), Expect = 0.93 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 8/74 (10%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKI------RFAVNDGRTATVPRY--DGLSSAFVTIVKK 345 H++AG + G ++ I PLD+ K R VN T Y G+ +AF TI + Sbjct: 91 HVIAGATAGAVASAITTPLDVAKTLLNTQERSVVNLVGTPKGHVYYVSGMFTAFRTIYQM 150 Query: 346 EGVRGLYRGVTPNV 387 G G ++G+ V Sbjct: 151 RGFPGYFQGLQARV 164 >SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) Length = 247 Score = 40.7 bits (91), Expect = 9e-04 Identities = 25/62 (40%), Positives = 31/62 (50%) Frame = +1 Query: 190 HLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYR 369 +L+AG GGVT PLD IK+R + G G VK EGVRGLY+ Sbjct: 72 NLIAGSVGGVTGVTAGQPLDTIKVRLQASFGA--------GPLDMLARTVKTEGVRGLYK 123 Query: 370 GV 375 G+ Sbjct: 124 GM 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/75 (28%), Positives = 36/75 (48%) Frame = +1 Query: 199 AGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVT 378 AG+ GV + I P + +K V + T RY GL + + + G+RG+++G+ Sbjct: 166 AGVFCGVCVSFIYAPTERVKCLLQVQK-ESGTKARYQGLGDCLLQVYRTGGLRGVFKGLG 224 Query: 379 PNVWGSGSAWGFYFL 423 P + GF+ L Sbjct: 225 PTMGREVIGGGFWTL 239 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 40.7 bits (91), Expect = 9e-04 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 2/100 (2%) Frame = +1 Query: 283 RTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGN 462 +T T Y+G+ F I+K+E V GLY+G+ + G G NAI +QG Sbjct: 184 QTQTNNVYNGVFDCFKQIIKRESVLGLYKGMASPLAGLG--------LINAIIFGVQGET 235 Query: 463 ARTPLGPG--LHMLAAAEAGVLSLVMTNPIWVVKTRLCLQ 576 R G G ++ A AG + ++ P+ + KTR+ +Q Sbjct: 236 LRRLNGSGTMAQAISGAIAGGVQSIVCCPMELAKTRVQVQ 275 Score = 33.5 bits (73), Expect = 0.13 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 13/132 (9%) Frame = +1 Query: 205 ISGGVTSTLILHPLDLIKIRFAVN-DGR--------TATVPR---YDGLSSAFVTIVKKE 348 I+GGV S ++ P++L K R V G+ T T + Y G + E Sbjct: 253 IAGGVQS-IVCCPMELAKTRVQVQGQGQKLVHVFFLTNTETKQMAYTGSLDCLKKVFHSE 311 Query: 349 GVRGLYRGVTPNVWGSGSAWGFYF-LFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLS 525 G+RG +RG+ A+ YF F + G L P + AG LS Sbjct: 312 GLRGCFRGMAITTTRDIPAFALYFGSFQYVCELLTPKGEHVDNLSPIRLFFSGGIAGTLS 371 Query: 526 LVMTNPIWVVKT 561 ++T P+ +VK+ Sbjct: 372 WILTYPVDMVKS 383 >SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 264 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 1/99 (1%) Frame = +1 Query: 154 SKLALLSHIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVT 333 SK+ S LVAG G+T+ +PLD+++ R A + A Y ++ Sbjct: 55 SKVLQTSSPAINKLVAGSLAGMTACACTYPLDMVRSRLAF---QVAQDQGYTTITQTIRC 111 Query: 334 I-VKKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTW 447 I VK+ G + LY+G P + A G F + +K + Sbjct: 112 ISVKEGGPKALYKGFVPTLLTIVPAMGIGFYMFETMKAY 150 >SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 200 Score = 39.5 bits (88), Expect = 0.002 Identities = 41/138 (29%), Positives = 58/138 (42%), Gaps = 11/138 (7%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKE-GVRGLYR 369 +VAG G+T+ +PLD+++ R A + A Y G+ I E G+ LYR Sbjct: 2 IVAGGLAGLTACSCTYPLDIVRSRLAF---QVADEHTYCGICQTVKQIFMTEGGMVALYR 58 Query: 370 GVTPNVWGSGSA--WGFY--------FLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGV 519 G TP A GFY F+ + T I T L +L A AG Sbjct: 59 GFTPTSLSMIPAVGIGFYAFESFKDFFVAMKGVLTRIHPETGETVLTAPGGLLCGALAGA 118 Query: 520 LSLVMTNPIWVVKTRLCL 573 S + P+ VV+ R+ L Sbjct: 119 TSQTLAYPLDVVRRRMQL 136 >SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) Length = 773 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/84 (27%), Positives = 36/84 (42%) Frame = +1 Query: 193 LVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRG 372 L G G + +PLD+++ R + G +Y F IV+ EG GL++G Sbjct: 685 LFCGAVAGAVAQSGTYPLDVVRRRMQMERGEGMF--KYSSTWDGFKVIVRSEGFIGLFKG 742 Query: 373 VTPNVWGSGSAWGFYFLFYNAIKT 444 + PN+ G F Y K+ Sbjct: 743 MWPNLLKVAPTIGIQFAVYEVSKS 766 >SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 313 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = +1 Query: 187 EHLVAGISGGVTSTLILHPLDLIKIRF-AVNDGRTATVPRYDGLSSAFVTIVKKEGVRGL 363 ++ AG GGV HPLD IK+R + + P + G + ++ EG GL Sbjct: 28 KNFFAGGFGGVCCIATGHPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGL 87 Query: 364 YRGVTPNVWGSGSAWGFYFLFYN 432 Y+G+ + G + F +N Sbjct: 88 YKGMAAPITGVTPIFAICFWGFN 110 >SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.1 bits (82), Expect = 0.011 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 4/131 (3%) Frame = +1 Query: 199 AGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVT 378 AG GG P D IK++ +T + L T K+EG +GLY G Sbjct: 15 AGAMGGTACVFAGQPFDTIKVKM-----QTFPSMSKNALDCGIKTF-KQEGFKGLYAGTI 68 Query: 379 PNVWGSGSAWGFYFLFY----NAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPI 546 P++ + + F FLFY + IKT + G + L + A + A + P Sbjct: 69 PSLAANIAENSFLFLFYGQCLSLIKT-LTGKKHESELTIFHNACAGSGAAFFMSFVLCPA 127 Query: 547 WVVKTRLCLQY 579 ++K RL Q+ Sbjct: 128 ELIKCRLQAQH 138 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +1 Query: 184 YEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVT----IVKKEG 351 + + AG + +L P +LIK R +T + G S + I++ +G Sbjct: 107 FHNACAGSGAAFFMSFVLCPAELIKCRLQAQH-QTNLISGMAGPKSGVIDVTMQIIRNDG 165 Query: 352 VRGLYRGVTPNVWGSGSAWGFYFLF 426 +GL+RG+T W + G++F F Sbjct: 166 FQGLFRGMTA-TW-AREVPGYFFFF 188 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +1 Query: 220 TSTLILHPLDLIKIRFAVNDGRTATVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWG 393 T ++P+DL+K R Y F +V+ EG GLYRG+ P + G Sbjct: 926 TGATAVYPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLPQLLG 983 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.23 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 +F Y+ +S NSCSPGDPL Sbjct: 2 VFLYLITRGVSSNSCSPGDPL 22 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 32.3 bits (70), Expect = 0.30 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 53 IYRHTLSQNSCSPGDPL 3 + RH ++ NSCSPGDPL Sbjct: 2 VQRHNVTSNSCSPGDPL 18 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.3 bits (70), Expect = 0.30 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -3 Query: 122 MTNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 M +FT++ S F + ++T I + + NSCSPGDPL Sbjct: 1 MKHFTDTLISANIVFLREFVYTVIQK--VVSNSCSPGDPL 38 >SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05) Length = 383 Score = 31.9 bits (69), Expect = 0.40 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 12/92 (13%) Frame = +1 Query: 133 KNPNPSSSKLALLSHIKYEHLVAGISGGVTSTLILHPLDLIKIRFAVNDGRTA------- 291 ++P P+S ++ Y LVA V LIL+P + + R + RT Sbjct: 262 EDPPPTSD----MTQSYYPELVANFMAFVVPDLILYPFETVLHRLYIQGTRTIIDDLDNA 317 Query: 292 --TVP---RYDGLSSAFVTIVKKEGVRGLYRG 372 +P Y + F TI ++EG+ G YRG Sbjct: 318 ADVIPLSTNYFSMLDCFRTIYQQEGIFGFYRG 349 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/20 (70%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -3 Query: 59 TYIYRHTL-SQNSCSPGDPL 3 TY+ H L S NSCSPGDPL Sbjct: 5 TYVTIHVLNSSNSCSPGDPL 24 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.53 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -3 Query: 122 MTNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 M +FT++ + A D+ T+++ S NSCSPGDPL Sbjct: 1 MKHFTDT---LISANISDIFTTFVFDPNTS-NSCSPGDPL 36 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.5 bits (68), Expect = 0.53 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 R T+S NSCSPGDPL Sbjct: 20 RKTISSNSCSPGDPL 34 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 31.5 bits (68), Expect = 0.53 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 IF+ R T + NSCSPGDPL Sbjct: 4 IFSQFSRATKTSNSCSPGDPL 24 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I +S NSCSPGDPL Sbjct: 1 MKHFTDTLISANIVLSRVSSNSCSPGDPL 29 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 31.1 bits (67), Expect = 0.70 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 Y H++ NSCSPGDPL Sbjct: 343 YLHSIVSNSCSPGDPL 358 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 71 DLIFTYIYRHTLSQNSCSPGDPL 3 DL+ +++ L NSCSPGDPL Sbjct: 3 DLVLSFLPLPCLRSNSCSPGDPL 25 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 2 LVDPPGCRNFGKVC 43 LVDPPGCRN KVC Sbjct: 70 LVDPPGCRNSMKVC 83 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 0.70 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 53 IYRHTLSQNSCSPGDPL 3 +Y +T NSCSPGDPL Sbjct: 16 LYYYTFGSNSCSPGDPL 32 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I H S NSCSPGDPL Sbjct: 1 MKHFTDTLISANIVSHNTS-NSCSPGDPL 28 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 122 MTNFTESHTSFVKAFCG-DLIFTYIYRHTLSQNSCSPGDPL 3 M +FT++ S +C L+ R NSCSPGDPL Sbjct: 1 MKHFTDTLISANILYCNKQLVIIRATRRKPQSNSCSPGDPL 41 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 53 IYRHTLSQNSCSPGDPL 3 I+R T+S NSCSPGDPL Sbjct: 7 IFR-TISSNSCSPGDPL 22 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 YR +L NSCSPGDPL Sbjct: 29 YRVSLISNSCSPGDPL 44 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 53 IYRHTLSQNSCSPGDPL 3 +Y +++ NSCSPGDPL Sbjct: 29 VYYRSITSNSCSPGDPL 45 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 ++ RH NSCSPGDPL Sbjct: 9 HLGRHLTGSNSCSPGDPL 26 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 V GD +F + NSCSPGDPL Sbjct: 249 VSIVLGDEVFREELEEIVGSNSCSPGDPL 277 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -3 Query: 68 LIFTYIYRHT-LSQNSCSPGDPL 3 LIFT Y + + NSCSPGDPL Sbjct: 5 LIFTIPYHNPRTTSNSCSPGDPL 27 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 +HT NSCSPGDPL Sbjct: 59 KHTNPSNSCSPGDPL 73 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H S NSCSPGDPL Sbjct: 3 HPFSSNSCSPGDPL 16 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I ++ NSCSPGDPL Sbjct: 1 MKHFTDTLISANIILIKITSNSCSPGDPL 29 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 +TL+ NSCSPGDPL Sbjct: 4 NTLASNSCSPGDPL 17 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 68 LIFTYIYRHTLSQNSCSPGDPL 3 L++TYI L NSCSPGDPL Sbjct: 47 LLYTYI---PLLSNSCSPGDPL 65 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 380 QMSGAPVRPGDSTFYFTMPLKHGYKEETLVLHSVP 484 QMSG + +F FT+ K+GY+ E L L P Sbjct: 626 QMSGRGYQSSTKSFLFTLCNKNGYRPEKLPLRRTP 660 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 T I + +S NSCSPGDPL Sbjct: 7 TLISANIISSNSCSPGDPL 25 >SB_26289| Best HMM Match : TLD (HMM E-Value=0.08) Length = 382 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +2 Query: 338 SRKKVFVAYTEELHQMSGAPVRPGDSTFYFTMPLKHGYKEETLVLHSVP 484 S K V + E + MSG + +F FT+ K+GY+ E L L P Sbjct: 260 STKPVCNTSSYEPNTMSGRGYQSSSRSFLFTLCNKNGYRPEKLPLRRTP 308 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -3 Query: 122 MTNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 M +FT++ + A G +++ I R + NSCSPGDPL Sbjct: 1 MKHFTDT---LISANIGHVVYINIIRQS---NSCSPGDPL 34 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 122 MTNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 M +FT++ S C + + I ++ NSCSPGDPL Sbjct: 1 MKHFTDTLIS-ANIHCEKIQISNILIPKIASNSCSPGDPL 39 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 IF + +S NSCSPGDPL Sbjct: 789 IFLRVMLVAISSNSCSPGDPL 809 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 TL+ NSCSPGDPL Sbjct: 2 TLASNSCSPGDPL 14 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 86 KAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 K IF + L+ NSCSPGDPL Sbjct: 645 KTIAFQYIFAILNSLQLASNSCSPGDPL 672 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 I Y YR +S NSCSPGDPL Sbjct: 418 INAYWYR-MVSSNSCSPGDPL 437 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 350 VFVAYTEELHQMSGAPVRPGDSTFYFTMPLKHGYKEETLVLHSVP 484 VF Y++ MS + +F FT+ K+GY+ E L L P Sbjct: 431 VFGGYSDVAWTMSDRGYQSSSRSFLFTLCNKNGYRPEKLPLRRTP 475 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I + NSCSPGDPL Sbjct: 1 MKHFTDTLISANIKGRHCASNSCSPGDPL 29 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 +LS NSCSPGDPL Sbjct: 3 SLSSNSCSPGDPL 15 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 48 PAHTFPKFLQPGGSTS 1 P+HT +FLQPGGSTS Sbjct: 18 PSHTPIEFLQPGGSTS 33 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H + NSCSPGDPL Sbjct: 11 HMMGSNSCSPGDPL 24 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 +H + NSCSPGDPL Sbjct: 20 QHVAASNSCSPGDPL 34 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 +LS NSCSPGDPL Sbjct: 5 SLSSNSCSPGDPL 17 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 56 YIYRHTLS-QNSCSPGDPL 3 +++R TL NSCSPGDPL Sbjct: 6 FVFRVTLEVSNSCSPGDPL 24 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 +F Y L+ NSCSPGDPL Sbjct: 2 VFLIPYFIMLASNSCSPGDPL 22 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 T+ Y ++ NSCSPGDPL Sbjct: 13 TWKYAIDIASNSCSPGDPL 31 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I NSCSPGDPL Sbjct: 1 MKHFTDTLISANIENKCCRSNSCSPGDPL 29 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 344 KKVFVAYTEELHQMSGAPVRPGDSTFYFTMPLKHGYKEETLVLHSVPAS 490 + VF YT+ S + + +F FT+ GYK L L + P+S Sbjct: 141 ENVFGGYTDRFWDNSRPRYKSSEKSFLFTLFNTEGYKPAKLSLKASPSS 189 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 LS NSCSPGDPL Sbjct: 23 LSSNSCSPGDPL 34 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 I + ++ S NSCSPGDPL Sbjct: 193 ICVFFLMYSSSSNSCSPGDPL 213 >SB_25855| Best HMM Match : OATP (HMM E-Value=1.2e-06) Length = 918 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 391 GSGSAWGFYFLFYNAIKTWIQGGNARTPLG 480 G GSAW + F+F+ A GG PLG Sbjct: 741 GDGSAWYYMFIFFLAEVMISAGGAPTVPLG 770 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -3 Query: 95 SFVKAFCGD-LIFTY--IYRHTLSQNSCSPGDPL 3 +++K GD +IF R ++ NSCSPGDPL Sbjct: 60 NYMKTLRGDYMIFIRRGAKRQQMASNSCSPGDPL 93 >SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 412 FYFLFYNAIKTWIQGGNARTPLGPGLHMLAAAEAGVLSLVMTNPIWVVKTRLCLQYSE 585 FY+ Y +K+ P G G H L+ A +G+ + ++T P VVKT ++ E Sbjct: 143 FYWFGYEFVKS-----QTHDP-GFGTHFLSGAISGLFAALITQPFDVVKTHRQIELGE 194 Score = 28.3 bits (60), Expect = 5.0 Identities = 22/79 (27%), Positives = 34/79 (43%) Frame = +1 Query: 298 PRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWGSGSAWGFYFLFYNAIKTWIQGGNARTPL 477 P + A + I + EG+ L+RG+ P + + YF Y+ +K N T L Sbjct: 58 PPFTSSIDALIKIPRYEGLSSLWRGLPPTMVMAVPNTVIYFTLYDQLKISYGFKNNETNL 117 Query: 478 GPGLHMLAAAEAGVLSLVM 534 MLA A L +V+ Sbjct: 118 WS--PMLAGITARKLDIVI 134 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLS---QNSCSPGDPL 3 +K F LI I R T+ NSCSPGDPL Sbjct: 1 MKHFTDTLISANIRRPTIQARKSNSCSPGDPL 32 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 TL NSCSPGDPL Sbjct: 13 TLRSNSCSPGDPL 25 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 LS NSCSPGDPL Sbjct: 34 LSSNSCSPGDPL 45 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 LS NSCSPGDPL Sbjct: 3 LSSNSCSPGDPL 14 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 68 LIFTYIYRHTLSQNSCSPGDPL 3 LI + T NSCSPGDPL Sbjct: 24 LILLIVPNATAQSNSCSPGDPL 45 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I NSCSPGDPL Sbjct: 1 MKHFTDTLISANIISIAFVSNSCSPGDPL 29 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 YR NSCSPGDPL Sbjct: 12 YRMFFQSNSCSPGDPL 27 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 LS NSCSPGDPL Sbjct: 66 LSSNSCSPGDPL 77 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 LS NSCSPGDPL Sbjct: 85 LSSNSCSPGDPL 96 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T++ NSCSPGDPL Sbjct: 3 TIASNSCSPGDPL 15 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T S NSCSPGDPL Sbjct: 49 TASSNSCSPGDPL 61 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T++ NSCSPGDPL Sbjct: 45 TITSNSCSPGDPL 57 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 +T + NSCSPGDPL Sbjct: 2 YTFTSNSCSPGDPL 15 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 + ++H +S NSCSPGDPL Sbjct: 35 WTFKHLIS-NSCSPGDPL 51 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 71 DLIFTYIYRHTLSQNSCSPGDPL 3 DL + I+ H NSCSPGDPL Sbjct: 1 DLFKSLIHNH--KSNSCSPGDPL 21 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = -3 Query: 134 FIVVMTNFTESHT--SFVKAFCGDLI---FTYIYRH--TLSQNSCSPGDPL 3 F++ +TN T+ T +F+ A + + +Y+H L NSCSPGDPL Sbjct: 31 FLLGITNVTQVRTVENFLLALFVNHVGRSCEVVYQHFPCLISNSCSPGDPL 81 >SB_24958| Best HMM Match : S-methyl_trans (HMM E-Value=1.6e-40) Length = 560 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 134 FIVVMTNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPG 12 F + T+ + +TS V + +F Y++ LSQ CSPG Sbjct: 446 FFAMFTSCFKPYTSSVSRYVFTRVFRYVFTRYLSQ--CSPG 484 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 +H NSCSPGDPL Sbjct: 14 KHKAKSNSCSPGDPL 28 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 YR NSCSPGDPL Sbjct: 6 YREYRGSNSCSPGDPL 21 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T S NSCSPGDPL Sbjct: 13 TASSNSCSPGDPL 25 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -3 Query: 53 IYRHTLS-QNSCSPGDPL 3 +YR+ ++ NSCSPGDPL Sbjct: 64 LYRYVMTPSNSCSPGDPL 81 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 68 LIFTYIYRHTLSQNSCSPGDPL 3 L+ ++ L NSCSPGDPL Sbjct: 15 LLKNVVWLQLLPSNSCSPGDPL 36 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 TY + HT S NSCSPGDPL Sbjct: 4 TY-FMHTRS-NSCSPGDPL 20 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 TL NSCSPGDPL Sbjct: 61 TLLSNSCSPGDPL 73 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQ---NSCSPGDPL 3 +K F LI I R T S+ NSCSPGDPL Sbjct: 1 MKHFTDTLISANITRVTNSRPRSNSCSPGDPL 32 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H + NSCSPGDPL Sbjct: 51 HFIPSNSCSPGDPL 64 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = -3 Query: 59 TYIYRHT--LSQNSCSPGDPL 3 +Y R++ +S NSCSPGDPL Sbjct: 12 SYFLRNSSNISSNSCSPGDPL 32 >SB_1082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 1 TSGSPGLQEFWESVCR*I*VNIRSPQNAFTN 93 TSGSPGLQEF VC NI++ N+ N Sbjct: 14 TSGSPGLQEFDNVVCN--ANNIKNEDNSDKN 42 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 1 TSGSPGLQEFWESVC 45 TSGSPGLQEF + +C Sbjct: 14 TSGSPGLQEFDDDLC 28 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 TL NSCSPGDPL Sbjct: 1 TLLSNSCSPGDPL 13 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 Y + ++ NSCSPGDPL Sbjct: 40 YCWPKDIASNSCSPGDPL 57 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 Y ++ NSCSPGDPL Sbjct: 6 YYKVITSNSCSPGDPL 21 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H + NSCSPGDPL Sbjct: 3 HNVISNSCSPGDPL 16 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 I + + H+LS NSCSPGDPL Sbjct: 76 IHSGLNEHSLS-NSCSPGDPL 95 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 +R T NSCSPGDPL Sbjct: 5 FRITAVSNSCSPGDPL 20 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 I+T + + NSCSPGDPL Sbjct: 9 IYTLDHTERRASNSCSPGDPL 29 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 65 IFTYIYRHTLSQNSCSPGDPL 3 + +I +L+ NSCSPGDPL Sbjct: 6 VVKWIDLKSLTSNSCSPGDPL 26 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 + L+ NSCSPGDPL Sbjct: 93 KRALASNSCSPGDPL 107 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 119 TNFTESHTSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 ++ T+S + + G L T Y+ NSCSPGDPL Sbjct: 2 SSLTKSSNDPRELYLGLLYPTEDYKVYPVSNSCSPGDPL 40 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 ++ R ++ NSCSPGDPL Sbjct: 40 WLSRVVVTSNSCSPGDPL 57 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 98 TSFVKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 T ++ C L+ + +S NSCSPGDPL Sbjct: 100 TEMGRSLCRQLVRAKNQKEIIS-NSCSPGDPL 130 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T+ NSCSPGDPL Sbjct: 9 TVGSNSCSPGDPL 21 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 +S NSCSPGDPL Sbjct: 4 ISSNSCSPGDPL 15 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 68 LIFTYIYRHTLSQNSCSPGDPL 3 L+F + NSCSPGDPL Sbjct: 18 LVFILLVHDHNQSNSCSPGDPL 39 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 T I + S NSCSPGDPL Sbjct: 7 TLISANINSSNSCSPGDPL 25 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 +T+ NSCSPGDPL Sbjct: 75 NTIVSNSCSPGDPL 88 >SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 +S NSCSPGDPL Sbjct: 1 MSSNSCSPGDPL 12 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 T I + + NSCSPGDPL Sbjct: 7 TLISANIVESNSCSPGDPL 25 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 89 VKAFCGDLIFTYIY-RHTLSQNSCSPGDPL 3 +K F LI I T+ NSCSPGDPL Sbjct: 1 MKHFTDTLISANIICSRTVLSNSCSPGDPL 30 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 86 KAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 K C I + + + NSCSPGDPL Sbjct: 2 KNCCVQCIVQELGEYLTASNSCSPGDPL 29 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 R S NSCSPGDPL Sbjct: 23 RTCFSSNSCSPGDPL 37 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 + H NSCSPGDPL Sbjct: 13 FNHLKVSNSCSPGDPL 28 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T + NSCSPGDPL Sbjct: 19 TFTSNSCSPGDPL 31 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 +S NSCSPGDPL Sbjct: 16 ISSNSCSPGDPL 27 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 50 YRHTLSQNSCSPGDPL 3 Y + + NSCSPGDPL Sbjct: 10 YPRSTASNSCSPGDPL 25 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 +S NSCSPGDPL Sbjct: 94 ISSNSCSPGDPL 105 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 +Y+ H+ S NSCSPGDPL Sbjct: 26 SYLTIHSAS-NSCSPGDPL 43 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H + NSCSPGDPL Sbjct: 15 HEQTSNSCSPGDPL 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T + NSCSPGDPL Sbjct: 7 TTTSNSCSPGDPL 19 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/15 (73%), Positives = 12/15 (80%), Gaps = 1/15 (6%) Frame = +2 Query: 2 LVDPPGCRN-FGKVC 43 LVDPPGCRN K+C Sbjct: 15 LVDPPGCRNSISKLC 29 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 53 IYRHTLSQNSCSPGDPL 3 + R + NSCSPGDPL Sbjct: 12 VQRFRIISNSCSPGDPL 28 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 R S NSCSPGDPL Sbjct: 9 RCVTSSNSCSPGDPL 23 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 77 CGDLIFTYIYRHTLSQNSCSPGDPL 3 C ++ + + + NSCSPGDPL Sbjct: 28 CNKMLGLCLKQANVPSNSCSPGDPL 52 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 Y R + NSCSPGDPL Sbjct: 3 YFGRPVPASNSCSPGDPL 20 >SB_38431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 67 RSPQNAFTNDVCDSVKFVMTTMKNPNPSSSKLALLSHIKYEHLVAGISGGVTST 228 +SP N CDS K +T + N ++L+ + EH+ G + T T Sbjct: 924 QSPDQEVDNIECDSQKQQPSTRRASNSPPAELSFIPDSSIEHVNVGNNSSGTQT 977 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 15 LTSNSCSPGDPL 26 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -3 Query: 59 TYIYRHTLSQ-NSCSPGDPL 3 T ++ LSQ NSCSPGDPL Sbjct: 53 TGLWSGALSQSNSCSPGDPL 72 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 158 LEDDGFGFFIVVMTNFTESHTSFVKAFCGDLIFTYIYRHTLS--QNSCSPGDPL 3 LE DG + + E T K C + R NSCSPGDPL Sbjct: 23 LEVDGIDKLDIAVIRLFEGFTCKPKRLCSREFCASLSRLQRQGRSNSCSPGDPL 76 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 78 LTSNSCSPGDPL 89 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 HT S NSCSPGDPL Sbjct: 23 HTAS-NSCSPGDPL 35 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 R + NSCSPGDPL Sbjct: 76 REVATSNSCSPGDPL 90 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 5 LASNSCSPGDPL 16 >SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1027 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 292 TVPRYDGLSSAFVTIVKKEGVRGLYRGVTPNVWG 393 T+ R G+ S + + RG YRGV VWG Sbjct: 873 TIVRSWGVRSGSRAVAGGQARRGCYRGVLGGVWG 906 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 59 TYIYRHTLSQNSCSPGDPL 3 T I + + NSCSPGDPL Sbjct: 7 TLISANIIISNSCSPGDPL 25 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 ++ + + NSCSPGDPL Sbjct: 13 FVQGNCMKSNSCSPGDPL 30 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H LS NSCSPGDPL Sbjct: 22 HVLS-NSCSPGDPL 34 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 R L NSCSPGDPL Sbjct: 21 RFPLISNSCSPGDPL 35 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 17 LASNSCSPGDPL 28 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T+ NSCSPGDPL Sbjct: 44 TVPSNSCSPGDPL 56 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 37 LTSNSCSPGDPL 48 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 20 LASNSCSPGDPL 31 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 11 LTSNSCSPGDPL 22 >SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 47 RHTLSQNSCSPGDPL 3 RHT NSCSPGDPL Sbjct: 5 RHT--SNSCSPGDPL 17 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 88 LTSNSCSPGDPL 99 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 56 YIYRHTLSQNSCSPGDPL 3 +I + NSCSPGDPL Sbjct: 48 FIENRLMRSNSCSPGDPL 65 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 41 TLSQNSCSPGDPL 3 T+ NSCSPGDPL Sbjct: 3 TIISNSCSPGDPL 15 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 11 LASNSCSPGDPL 22 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 7 LASNSCSPGDPL 18 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 11 LTSNSCSPGDPL 22 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 38 LSQNSCSPGDPL 3 L+ NSCSPGDPL Sbjct: 4 LASNSCSPGDPL 15 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHT-LSQNSCSPGDPL 3 +K F LI I T S NSCSPGDPL Sbjct: 1 MKHFTDTLISANIKALTNKSSNSCSPGDPL 30 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 89 VKAFCGDLIFTYIYRHTLSQNSCSPGDPL 3 +K F LI I +T NSCSPGDPL Sbjct: 1 MKHFTDTLISANIIVYT--SNSCSPGDPL 27 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 44 HTLSQNSCSPGDPL 3 H NSCSPGDPL Sbjct: 3 HEKKSNSCSPGDPL 16 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,141,306 Number of Sequences: 59808 Number of extensions: 520355 Number of successful extensions: 2752 Number of sequences better than 10.0: 177 Number of HSP's better than 10.0 without gapping: 2619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2732 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -