BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0460 (564 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 23 1.8 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 3.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 4.2 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 5.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 48 MKTIICLFTSAGRGNGS 98 M T IC+ S+GR NGS Sbjct: 1 MSTRICIPISSGRTNGS 17 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 148 ARMFTEVVKNNPGKSVVLS 204 AR FT+ +KN G +V++ Sbjct: 434 ARFFTDCIKNREGFEMVIA 452 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 309 YSIVVREADSFQK 271 YSI++++ADSF K Sbjct: 306 YSILIKKADSFCK 318 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 5.5 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = -1 Query: 552 LTKSLMRLLGIFFYPIVNRLSCDCILREINVLDVRIEDV 436 L+ +++ L+ ++ + + + CD ILRE + + V + V Sbjct: 195 LSINIISLVQLWIFQLYLLILCDQILREFDQIVVILSKV 233 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 521 IPNNRIKDLVNP 556 +P N+ DLVNP Sbjct: 1201 VPQNKRDDLVNP 1212 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 521 IPNNRIKDLVNP 556 +P N+ DLVNP Sbjct: 1201 VPQNKRDDLVNP 1212 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 521 IPNNRIKDLVNP 556 +P N+ DLVNP Sbjct: 1201 VPQNKRDDLVNP 1212 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 521 IPNNRIKDLVNP 556 +P N+ DLVNP Sbjct: 1201 VPQNKRDDLVNP 1212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,262 Number of Sequences: 336 Number of extensions: 2426 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -