BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0459 (491 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.1 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 8.0 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 8.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 141 LTIMEVVAALKPTSFDTSIFLTSYRSGNFSKNIQF 37 +T V A + S + +FL +R+G + +I F Sbjct: 457 MTFQNVFAVINVFSGELPVFLQEHRNGMYRPSIYF 491 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 141 LTIMEVVAALKPTSFDTSIFLTSYRSGNFSKNIQF 37 +T V A + S + +FL +R+G + +I F Sbjct: 457 MTFQNVFAVINVFSGELPVFLQEHRNGMYRPSIYF 491 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 20.6 bits (41), Expect = 8.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 91 EHISHFLSIREFLQEYSVLTVKLTLV 14 EH + S R + + TVK+TLV Sbjct: 265 EHDTRRASSRGIIPRAKIKTVKMTLV 290 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 232 WQSPRCQPCCRERAE 276 WQ R CC+E E Sbjct: 81 WQMERSCMCCQESGE 95 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,331 Number of Sequences: 336 Number of extensions: 2169 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11525470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -