BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0459 (491 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M73031-1|AAA58630.1| 108|Homo sapiens coupling factor 6 protein. 56 5e-08 M37104-1|AAA51807.1| 108|Homo sapiens ATPase coupling factor 6 ... 56 5e-08 CR456950-1|CAG33231.1| 108|Homo sapiens ATP5J protein. 56 5e-08 BT007244-1|AAP35908.1| 108|Homo sapiens ATP synthase, H+ transp... 56 5e-08 BC001178-1|AAH01178.1| 108|Homo sapiens ATP synthase, H+ transp... 56 5e-08 AY544129-1|AAT11160.1| 108|Homo sapiens proliferation-inducing ... 56 5e-08 BC066310-1|AAH66310.1| 108|Homo sapiens ATP synthase, H+ transp... 53 6e-07 AK126070-1|BAC86424.1| 361|Homo sapiens protein ( Homo sapiens ... 29 6.6 AK125847-1|BAC86316.1| 917|Homo sapiens protein ( Homo sapiens ... 29 6.6 >M73031-1|AAA58630.1| 108|Homo sapiens coupling factor 6 protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYHQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >M37104-1|AAA51807.1| 108|Homo sapiens ATPase coupling factor 6 subunit protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >CR456950-1|CAG33231.1| 108|Homo sapiens ATP5J protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >BT007244-1|AAP35908.1| 108|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >BC001178-1|AAH01178.1| 108|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >AY544129-1|AAT11160.1| 108|Homo sapiens proliferation-inducing protein 36 protein. Length = 108 Score = 56.4 bits (130), Expect = 5e-08 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M FP+ KFE+PK + I++ A Sbjct: 87 MNTFPTFKFEDPKFEVIEKPQA 108 >BC066310-1|AAH66310.1| 108|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 protein. Length = 108 Score = 52.8 bits (121), Expect = 6e-07 Identities = 33/82 (40%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Frame = +2 Query: 155 AAQKATDPIQQLFLDKIREYKQK--SAGGKVPDASPAVXXXXXXXXXXXXXQYGGGPGID 328 A K DPIQ+LF+DKIREYK K ++GG V DAS +G D Sbjct: 31 AFNKELDPIQKLFVDKIREYKSKRQTSGGPV-DASSEYQQELERELFKLKQMFGNA---D 86 Query: 329 MTAFPSLKFEEPKLDPIDEQAA 394 M F + KFE+PK + I++ A Sbjct: 87 MNTFHTFKFEDPKFEVIEKPQA 108 >AK126070-1|BAC86424.1| 361|Homo sapiens protein ( Homo sapiens cDNA FLJ44082 fis, clone TESTI4040800. ). Length = 361 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 119 PPSNQPVLIRAYFSLPIDQGISPRIFSFDSEINPRAE 9 PP+ PVL+R F + + I P F SE+ + E Sbjct: 226 PPAPNPVLVRKSFKVHVPISIIPGDFPLSSEVRKKLE 262 >AK125847-1|BAC86316.1| 917|Homo sapiens protein ( Homo sapiens cDNA FLJ43859 fis, clone TESTI4007382. ). Length = 917 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 119 PPSNQPVLIRAYFSLPIDQGISPRIFSFDSEINPRAE 9 PP+ PVL+R F + + I P F SE+ + E Sbjct: 649 PPAPNPVLVRKSFKVHVPISIIPGDFPLSSEVRKKLE 685 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,190,604 Number of Sequences: 237096 Number of extensions: 1470924 Number of successful extensions: 2069 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2062 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4423060356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -