BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0458 (523 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 1.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 5.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 5.8 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 7.7 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 158 LQYSGKTTFVNVIASGQFSEDMI--PTV 235 L++S ++N I GQF D+I PTV Sbjct: 75 LKFSNIAPYLNQIYGGQFVRDLIWTPTV 102 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 5.8 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +1 Query: 217 RHDSNSRFQHAQSNQRKRNNQGMGYWWPTKIPFNVGALLQRGQ 345 +H +SR N +N QG IP N ALL + Sbjct: 164 QHHLDSRVIQEAQNIAIQNTQGKNNQQNILIPVNYSALLSHDE 206 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 260 KGNVTIKVWDIGGQPRFR 313 KGN+ K+W + G+ + R Sbjct: 1015 KGNMQWKIWPMKGEEKSR 1032 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 47 RLNLDFNHSEMLALINRILDWIKSLFWKEEMELTLVG 157 R+N + MLAL NR+ + + F +E+ ++G Sbjct: 369 RMNRIHKNEYMLALSNRMQKIVNNDFNFDEVNFRILG 405 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +1 Query: 217 RHDSNSRFQHAQSNQRKRNNQ 279 ++D+N + +N +K NNQ Sbjct: 429 QNDNNQKNNKKNANNQKNNNQ 449 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,334 Number of Sequences: 438 Number of extensions: 2683 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -