BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0455 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 29 0.081 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 29 0.14 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 27 0.33 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 27 0.43 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 27 0.57 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 27 0.57 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 27 0.57 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 1.7 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.3 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 25 2.3 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 3.0 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 3.0 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 4.0 AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 24 4.0 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 4.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 4.0 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 5.3 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 5.3 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 5.3 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 5.3 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 5.3 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 23 7.0 AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding pr... 23 7.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 7.0 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 7.0 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 9.3 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 23 9.3 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 23 9.3 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.3 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.3 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 29.5 bits (63), Expect = 0.081 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = -1 Query: 513 RQYCPAHRNIITELEPAQCCH-PNPKPG*YRPAAPLSRRLSPMLQVLDPPIEVPAGDPGS 337 +Q P R+ L PA H P P P A R +P + PP PG+ Sbjct: 142 QQQHPHQRDTGPALFPAPISHRPPPIAHQQAPFAMDPARPNPGM----PPGPQMMRPPGN 197 Query: 336 AGRPKSGSTETTSRPPRP 283 G P++G T T +PPRP Sbjct: 198 VGPPRTG-TPTQPQPPRP 214 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 28.7 bits (61), Expect = 0.14 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 130 HTASVCTHQQLCPNCNGRHHALLC 201 H+A C +C C +HH+ LC Sbjct: 385 HSARECRSTYVCQQCKRKHHSKLC 408 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 27.5 bits (58), Expect = 0.33 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -1 Query: 372 PPIEVPAGDPGSAGRPK-SGSTETTSRP---PRPLHWRESRSVPS 250 PPI V D S G P S S + T RP P W + +S S Sbjct: 161 PPITVSGSDMSSPGAPTGSSSPQITPRPTPVKSPYEWMKKQSYQS 205 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 27.1 bits (57), Expect = 0.43 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 130 HTASVCTHQQLCPNCNGRH 186 H A VCT Q C C G H Sbjct: 693 HMAKVCTSQPKCLKCGGPH 711 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 26.6 bits (56), Expect = 0.57 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 128 RTRQASAHTS-SCARTATVGTMPCCAWKIRSYGRSQPASPTGEGTDRDSRQC 280 R+R +S S SC+R A A + + + +S +G G DRD C Sbjct: 277 RSRSSSLSRSRSCSRQAETPRADDRALNLDTKSKPSTSSSSGTGCDRDDGDC 328 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 26.6 bits (56), Expect = 0.57 Identities = 24/80 (30%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Frame = +2 Query: 32 HTYHRVKV-PVDAHEGQTQHRCPATMVFFFVSGRTRQASAHTSSCARTATVGTMPCCAWK 208 H HR+ V PV A + H F G ++S H AR T P W Sbjct: 10 HLLHRMDVLPVPAEHREHLHESG----FVRRQGSHAKSSVHKLCHARNTT---QPRTRWY 62 Query: 209 IRSYGRSQPASPTGEGTDRD 268 I ++ + P TG TD D Sbjct: 63 IPAFFAAHPTDRTGCPTDPD 82 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 338 RPAGRSLAPPKPPPDHPGLYIGESHDRY 255 RPAG L PP PP + GE+ D + Sbjct: 704 RPAGSELTPPGPPDEKD--VCGENEDNF 729 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 25.0 bits (52), Expect = 1.7 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +3 Query: 309 RWSQTSAGRPNQGRQPGLQWEDLALEASGRGAWRVVLRAGTSQVLDSDGNTV 464 RW Q + Q R P QW ++ S R + V + +S V D G V Sbjct: 193 RWRQQQQKQQRQQRLPAQQWP--TVQQSVRAQRQGVTESASSAVPDEAGTWV 242 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 130 HTASVCTHQQLCPNCNGRH 186 H AS CT++ C C G H Sbjct: 496 HKASGCTNEVKCMLCGGAH 514 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.6 bits (51), Expect = 2.3 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 130 HTASVCTHQQLCPNCNGRHH 189 H A C ++ C C G HH Sbjct: 539 HKARSCQNEAKCALCGGAHH 558 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 130 HTASVCTHQQLCPNCNGRH 186 H A CT + C CNG H Sbjct: 421 HYAKSCTSEIKCAACNGPH 439 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.2 bits (50), Expect = 3.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 120 FRAAHGKRLHTPAAVPELQRSAPCPVVPG 206 ++A HG L T +VP L+ A P PG Sbjct: 63 YQATHGL-LQTHPSVPSLKPVAGAPAAPG 90 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.2 bits (50), Expect = 3.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 120 FRAAHGKRLHTPAAVPELQRSAPCPVVPG 206 ++A HG L T +VP L+ A P PG Sbjct: 63 YQATHGL-LQTHPSVPSLKPVAGAPAAPG 90 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.8 bits (49), Expect = 4.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 94 PSDDGVFFCFGPHTASVCTHQQLCPNCNGRHHALL 198 P G FFCFG + TH N +HAL+ Sbjct: 361 PDGFGAFFCFGECNFPLNTHM------NATNHALI 389 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 23.8 bits (49), Expect = 4.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 97 WATMLRLPLMRVDRNF 50 W T +RLP MR++ N+ Sbjct: 129 WETHIRLPKMRLEGNY 144 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 4.0 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = -2 Query: 329 GRSLAPPKPPPDHPGLYIGESHDRYPHRSARLAGCARMTEFSRHNRAWCRPL 174 G + A P P + Y S+D +P + A G T + R W R L Sbjct: 263 GLTTASPVEPEEGVDFYEELSYDNHPCKRACTLGRKPETCYYRFRLEWYRTL 314 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 4.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 375 DPPIEVPAGDPGSAGRP 325 +P + PAG PG+ GRP Sbjct: 162 EPGPKGPAGHPGAPGRP 178 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 5.3 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +3 Query: 375 LALEASGRG--AWRVVLRAGTSQVLDSDGNTVLARALLL 485 ++LEA+ A RVV + +++ D V+ARALLL Sbjct: 120 MSLEANDLSIVAHRVVEQMVARELIHEDDKPVIARALLL 158 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 135 GKRLHTPAAVP-ELQRSAPCPVVPGKFGHTGAASQPRRPV 251 G R TP A P L RS+P P K ++ P R + Sbjct: 1445 GGRQSTPPASPARLARSSPASPTPSKKSKRHQSASPIRHI 1484 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.4 bits (48), Expect = 5.3 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 120 TKKNTIVAGQRCCVCPSCASTGTLTR*YVC-PLSCS 16 T+K + G+ C C S LT Y C PLS S Sbjct: 90 TQKTCALNGEYCLTHMECCSGNCLTFSYKCVPLSPS 125 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 149 HTSSCARTATVGTMPCCAWKIRSYGRSQPASPTGEGTDRD 268 H+S+ A +++V T+P + + R+ G S + + RD Sbjct: 49 HSSTSASSSSVPTLPTTSGEPRAAGSSSNSRRNSKQLQRD 88 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 149 HTSSCARTATVGTMPCCAWKIRSYGRSQPASPTGEGTDRD 268 H+S+ A +++V T+P + + R+ G S + + RD Sbjct: 49 HSSTSASSSSVPTLPTTSGEPRAAGSSSNSRRNSKQLQRD 88 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 384 QVLDPPIEVPAGDPGSAGRPKSGSTETT 301 ++LD + VP GD AGR + TT Sbjct: 395 RILDRWMAVPQGDDEQAGRGQHQDAATT 422 >AY330173-1|AAQ16279.1| 202|Anopheles gambiae odorant-binding protein AgamOBP46 protein. Length = 202 Score = 23.0 bits (47), Expect = 7.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 369 PIEVPAGDPGSAGRPKSGSTETTS 298 PI+ A D G+A PK+ T+ S Sbjct: 57 PIDKDAADKGAASMPKTEVTDCMS 80 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 294 PPRPLHWRESRSVPSPVGEAGWLRP 220 P RP+ R + P+P G ++RP Sbjct: 62 PDRPIPGRSHPAEPAPGGNGPFVRP 86 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 321 SGSTETTSRPPRPLHWRESRSVPSPVG 241 + TE RP L + +S SVP VG Sbjct: 727 ANQTEFVGRPDTDLSYTKSVSVPPKVG 753 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 22.6 bits (46), Expect = 9.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 160 AAGVCRRLPCAARNKKKHH 104 AAG C R P R + HH Sbjct: 100 AAGFCARRPRKVRKLQHHH 118 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 68 HEGQTQHRCPATMVFFFVSGRTRQASAHT 154 H QT+++C T V +VS R+ T Sbjct: 240 HAKQTEYQCRLTYVLEYVSAPKRRREMMT 268 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 22.6 bits (46), Expect = 9.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 31 AYVSSCQSSGRRA*GADATSLPSDDG 108 AYV+ C RRA AT L +DG Sbjct: 144 AYVAPCGQEIRRAVSDCATMLQVEDG 169 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 22.6 bits (46), Expect = 9.3 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -2 Query: 416 HHSPGASPR-CFKC*ILP--LKSRLATLVRPAGRSLAPPKPPPDHPGL 282 H P + PR F LP L + L +RP G L P P HP L Sbjct: 540 HMMPHSLPRPFFSIPGLPPGLSAPLGLGMRPQGGPLGLPSHHPLHPSL 587 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 Query: 205 PGTTGHGADRCSS 167 PG TG DRC S Sbjct: 419 PGVTGEKCDRCDS 431 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,640 Number of Sequences: 2352 Number of extensions: 18473 Number of successful extensions: 74 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -