BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0453 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 25 0.73 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.3 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.6 bits (51), Expect = 0.73 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 20 RDAPVEAPRLTGRCPRTIVGECSYRRTSPVY 112 R PVE PR CP E ++SP + Sbjct: 334 RSEPVEPPRRKNNCPLHCKPELGQSQSSPKF 364 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.3 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +2 Query: 20 RDAPVEAPRLTGRCPRTIVGECSY 91 ++ P+E LT R ++G C++ Sbjct: 168 KNEPIECRELTARFTTDVIGSCAF 191 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,994 Number of Sequences: 438 Number of extensions: 2995 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -