BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0448 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) 31 0.95 SB_12890| Best HMM Match : A2M_recep (HMM E-Value=1.8e-25) 27 8.8 SB_25430| Best HMM Match : MFS_1 (HMM E-Value=1.3e-33) 27 8.8 >SB_18399| Best HMM Match : AMP-binding (HMM E-Value=0) Length = 1381 Score = 30.7 bits (66), Expect = 0.95 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 457 NCIYCSLEITMHLFKTTAGLLSKLFFTSDCTMCAGTLLI 341 +CI I HLF+ + KL+ S+C++C ++++ Sbjct: 1267 SCIASGTTIQSHLFEDRVMKMDKLYIGSECSVCCDSIVL 1305 >SB_12890| Best HMM Match : A2M_recep (HMM E-Value=1.8e-25) Length = 203 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 216 RFCLKIVYPKFNFYTFLVFLTIKHRIW 296 RFC ++ + F TF++FL +K +W Sbjct: 84 RFCSNLLLLR-GFSTFIIFLMVKRNLW 109 >SB_25430| Best HMM Match : MFS_1 (HMM E-Value=1.3e-33) Length = 607 Score = 27.5 bits (58), Expect = 8.8 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = -1 Query: 552 VFYVCACFYSLCSILKKAKEHLCLRKTSSH*PTVYTVL*R*QCI-CLKRQLDYYPNYFSQ 376 ++ V CF+ ++K A++H + KT S V+ + L R DY P+Y Q Sbjct: 242 IWVVALCFFMPAILVKFAEDHN-IEKTKSSTVVVFFAIGSITFRPILGRLSDYLPSYRLQ 300 Query: 375 VIARCALV 352 + C LV Sbjct: 301 IFQLCFLV 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,576,039 Number of Sequences: 59808 Number of extensions: 309848 Number of successful extensions: 673 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -