BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0447 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 6.0 AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha su... 23 6.0 AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha su... 23 6.0 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 321 EATNRIGLLTHEFLLDVLSDLSIVEEVAVFSDFPC 217 + R + EF+L + DL+ E ++S F C Sbjct: 290 DGPQRDAIAAREFILRMFVDLNPDSEKIIYSHFTC 324 >AY724805-1|AAW50314.1| 162|Anopheles gambiae G protein alpha subunit AgGq3 protein. Length = 162 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 321 EATNRIGLLTHEFLLDVLSDLSIVEEVAVFSDFPC 217 + R + EF+L + DL+ E ++S F C Sbjct: 103 DGPQRDAIAAREFILRMFVDLNPDSEKIIYSHFTC 137 >AY724804-1|AAW50313.1| 163|Anopheles gambiae G protein alpha subunit AgGq2 protein. Length = 163 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 321 EATNRIGLLTHEFLLDVLSDLSIVEEVAVFSDFPC 217 + R + EF+L + DL+ E ++S F C Sbjct: 104 DGPQRDAIAAREFILRMFVDLNPDSEKIIYSHFTC 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,591 Number of Sequences: 2352 Number of extensions: 11058 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -