BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0447 (617 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC066341-1|AAH66341.1| 183|Homo sapiens FTH1 protein protein. 35 0.26 >BC066341-1|AAH66341.1| 183|Homo sapiens FTH1 protein protein. Length = 183 Score = 34.7 bits (76), Expect = 0.26 Identities = 21/86 (24%), Positives = 41/86 (47%) Frame = +1 Query: 151 DRSPGQSL*HAEAAWPRGFSSSTGEVTKNSDLLHDAEITQYIEEEFVSQQADTIRSLAGH 330 D GQ+ + + S E+ K + +D + +IE ++++Q I+ L H Sbjct: 93 DWESGQNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDH 152 Query: 331 TSDLKRFITENNGKDLSLAVYLFDEY 408 ++L++ +G LA YLFD++ Sbjct: 153 VTNLRKMGAPESG----LAEYLFDKH 174 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,588,941 Number of Sequences: 237096 Number of extensions: 1683312 Number of successful extensions: 3020 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3020 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6635341780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -