BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0446 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003150-5|AAB54213.1| 474|Caenorhabditis elegans Hypothetical ... 28 4.6 Z79759-2|CAB02137.1| 255|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AF003150-5|AAB54213.1| 474|Caenorhabditis elegans Hypothetical protein T05E7.1 protein. Length = 474 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 211 YVISQLLPGEHFG*FPDFPAH 149 +V S+L+PG HF FP FP H Sbjct: 383 HVESELVPGGHFLYFPYFPHH 403 >Z79759-2|CAB02137.1| 255|Caenorhabditis elegans Hypothetical protein ZK858.2 protein. Length = 255 Score = 27.5 bits (58), Expect = 8.1 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = -2 Query: 566 KVSKPATVCWSPSLDLRNLTWMVYHISV*GL**TICRQPFQRPLAHCYIERRIFLFRSRQ 387 +V+ P TV + + +R L YHIS L + + R + RR+ R+RQ Sbjct: 41 EVATPVTVSPTDFMPIRELVTTPYHISTPVLITPVDARSISREIVRVNRIRRV---RTRQ 97 Query: 386 ASRMV 372 ASR V Sbjct: 98 ASRSV 102 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,972,085 Number of Sequences: 27780 Number of extensions: 249943 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -