BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0440 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyce... 29 0.68 SPAC1039.03 |||esterase/lipase |Schizosaccharomyces pombe|chr 1|... 27 2.7 SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 26 3.6 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 25 8.4 >SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 242 Score = 28.7 bits (61), Expect = 0.68 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +1 Query: 319 LYLLAELKT-ISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKSV 495 +++L ELK +KV + PP + PI++D+G+ +E+ I H+++ Sbjct: 16 VWMLEELKVPYEIKVYDRVDGRAPPAYTKLSPLGKSPIVVDDGVTYIESAAILEHLVRKY 75 Query: 496 PGGHNLFVQDKEVASL 543 G + +++VA L Sbjct: 76 --GPSFKPSEEDVAEL 89 >SPAC1039.03 |||esterase/lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 341 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 598 SVHLCEPAPASVLNTGSRLETRPPCPARI 512 + H+CE A V+N RL P PA I Sbjct: 123 ATHMCEQAKCVVVNVDYRLAPEDPFPACI 151 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 104 FQNTDKLPYFRLVISRRSNLAKSR*VSNPRA 12 F+NT +LP +++ RR L + SNP A Sbjct: 229 FENTPQLPAAKMMWYRRHYLPNEKDWSNPEA 259 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 463 EKIERHIMKSVPGGHNLFVQDKEVASLIENLYSKLKLVL 579 +KIERHI S+ L + D ++E+L++ L V+ Sbjct: 67 KKIERHIYISLNSIQLLAINDALSPDILESLFNSLNAVI 105 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.0 bits (52), Expect = 8.4 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 55 GATWQKVGRYQTLVPNSC 2 G W K+GR +PN C Sbjct: 332 GKCWTKIGRKMARMPNDC 349 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,598,895 Number of Sequences: 5004 Number of extensions: 54841 Number of successful extensions: 144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -