BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0439 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 7.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.6 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 4.1 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 126 TISLGLRSGDLPK-SPIFAISVYLKLKF 46 TIS G+RS LP+ S + AI +YL + F Sbjct: 286 TISTGVRSS-LPRISYVKAIDIYLVMCF 312 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 246 INKYALY*QKKSSDPGKQSIKYTQVKHISTQYNYK 350 I KY ++ ++ + I +KHI+T++N K Sbjct: 197 IEKYKMFCNLENVKLKELRIILEDIKHINTRHNTK 231 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 401 AIKKKKKNCQTNPIDSSFVIV 339 A KKK + + PID+ F I+ Sbjct: 627 AQKKKHRAIRPEPIDAQFDII 647 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,732 Number of Sequences: 438 Number of extensions: 3042 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -