BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0433 (377 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 36 0.011 SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 36 0.011 SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 36 0.011 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.014 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.025 SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) 34 0.044 SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) 34 0.044 SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.044 SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) 34 0.044 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.058 SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) 33 0.058 SB_15983| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.058 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 33 0.058 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 33 0.058 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.058 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.058 SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) 33 0.058 SB_44569| Best HMM Match : Gal_Lectin (HMM E-Value=4.5) 33 0.058 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 33 0.058 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 33 0.058 SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) 33 0.077 SB_33763| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 33 0.077 SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.077 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 33 0.077 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.077 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 33 0.077 SB_50448| Best HMM Match : RVT_1 (HMM E-Value=3.7) 33 0.077 SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) 33 0.077 SB_5801| Best HMM Match : UvdE (HMM E-Value=2.2) 33 0.077 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 33 0.10 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 32 0.18 SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) 32 0.18 SB_40446| Best HMM Match : RVT_1 (HMM E-Value=2.2e-16) 32 0.18 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 32 0.18 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 32 0.18 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 32 0.18 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.18 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 32 0.18 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 32 0.18 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 32 0.18 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.18 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 32 0.18 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 32 0.18 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 32 0.18 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 32 0.18 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 32 0.18 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 31 0.23 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 31 0.23 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.23 SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 31 0.31 SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) 31 0.31 SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24) 31 0.31 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 31 0.31 SB_32049| Best HMM Match : RVT_1 (HMM E-Value=6.7e-15) 31 0.31 SB_23604| Best HMM Match : RVT_1 (HMM E-Value=4.6e-13) 31 0.31 SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_19280| Best HMM Match : RVT_1 (HMM E-Value=3.5e-12) 31 0.31 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 31 0.31 SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 31 0.41 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 31 0.41 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 31 0.41 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 31 0.41 SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) 31 0.41 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) 31 0.41 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 31 0.41 SB_18998| Best HMM Match : Exo_endo_phos (HMM E-Value=1.1e-10) 31 0.41 SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) 31 0.41 SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 31 0.41 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 30 0.54 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 30 0.54 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 30 0.54 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 30 0.54 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 30 0.54 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 30 0.54 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.54 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 30 0.54 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.54 SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 30 0.54 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 30 0.54 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.72 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 30 0.72 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 30 0.72 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 30 0.72 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 30 0.72 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 30 0.72 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 30 0.72 SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.72 SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) 30 0.72 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 30 0.72 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 29 0.95 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 29 0.95 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 29 0.95 SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) 29 0.95 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 29 0.95 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 29 0.95 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 29 0.95 SB_5866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 29 0.95 SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.95 SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) 29 0.95 SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) 29 0.95 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 29 1.3 SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12) 29 1.3 SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 29 1.3 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 29 1.3 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 29 1.3 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 29 1.3 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 29 1.3 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.3 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.3 SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) 29 1.3 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) 29 1.3 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 29 1.3 SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.3 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 29 1.3 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 29 1.3 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 29 1.3 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.3 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 29 1.3 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 29 1.3 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 29 1.3 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.3 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 29 1.7 SB_51005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 29 1.7 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 29 1.7 SB_40349| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) 29 1.7 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 29 1.7 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 29 1.7 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 29 1.7 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 29 1.7 SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 29 1.7 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 29 1.7 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 29 1.7 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 29 1.7 SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) 29 1.7 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 29 1.7 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 29 1.7 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 28 2.2 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 28 2.2 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_23576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.2 SB_22310| Best HMM Match : Exo_endo_phos (HMM E-Value=0.12) 28 2.2 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_49551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 28 2.9 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_39823| Best HMM Match : HECT (HMM E-Value=4.5) 28 2.9 SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083) 28 2.9 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 28 2.9 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 28 2.9 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 2.9 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_31422| Best HMM Match : RVT_1 (HMM E-Value=1) 28 2.9 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 28 2.9 SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) 28 2.9 SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_20861| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) 28 2.9 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 28 2.9 SB_17711| Best HMM Match : HECT (HMM E-Value=4.9) 28 2.9 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 28 2.9 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_7771| Best HMM Match : RVT_1 (HMM E-Value=5.3e-13) 28 2.9 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 28 2.9 SB_6517| Best HMM Match : RVT_1 (HMM E-Value=2.3) 28 2.9 SB_2508| Best HMM Match : RVT_1 (HMM E-Value=1e-05) 28 2.9 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 28 2.9 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.9 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_57918| Best HMM Match : RVT_1 (HMM E-Value=1.1e-28) 28 2.9 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) 28 2.9 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.9 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.9 SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) 28 2.9 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 28 2.9 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 28 2.9 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.9 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.9 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 28 2.9 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) 28 2.9 SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_42431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 27 3.8 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 27 3.8 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 27 3.8 SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_52566| Best HMM Match : Baculo_FP (HMM E-Value=1.7) 27 3.8 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_27893| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 27 3.8 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.8 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.1 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.1 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.1 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 27 5.1 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 27 5.1 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 27 5.1 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 27 5.1 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 27 5.1 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 27 5.1 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) 27 5.1 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.1 SB_10516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 27 5.1 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 27 6.7 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 27 6.7 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 27 6.7 SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) 27 6.7 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 27 6.7 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_33611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 27 6.7 SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 27 6.7 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_18451| Best HMM Match : Sorb (HMM E-Value=9.2) 27 6.7 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_15188| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_57557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_48424| Best HMM Match : PSI (HMM E-Value=0.4) 27 6.7 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 27 6.7 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 27 6.7 SB_45172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 27 6.7 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 27 6.7 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 27 6.7 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 27 6.7 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 27 6.7 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 27 6.7 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 27 6.7 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 27 6.7 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 27 6.7 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) 27 6.7 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.7 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 27 6.7 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_8622| Best HMM Match : RVT_1 (HMM E-Value=1.8e-35) 27 6.7 SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) 27 6.7 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 27 6.7 SB_4370| Best HMM Match : PSI (HMM E-Value=0.4) 27 6.7 SB_58764| Best HMM Match : Sex_peptide (HMM E-Value=5.7) 26 8.8 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 26 8.8 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 26 8.8 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 26 8.8 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 26 8.8 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 26 8.8 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 26 8.8 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 26 8.8 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 26 8.8 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 26 8.8 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 26 8.8 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 26 8.8 SB_8258| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 26 8.8 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 26 8.8 SB_52166| Best HMM Match : Exo_endo_phos (HMM E-Value=5.6e-10) 26 8.8 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_32202| Best HMM Match : RVT_1 (HMM E-Value=0.1) 26 8.8 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 26 8.8 SB_23276| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) 26 8.8 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 26 8.8 SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022) 26 8.8 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 26 8.8 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 26 8.8 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 26 8.8 >SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) Length = 768 Score = 35.9 bits (79), Expect = 0.011 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G F S Sbjct: 578 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPFLFS 615 >SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 290 Score = 35.9 bits (79), Expect = 0.011 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V V G +S L GVPQG G F S Sbjct: 170 LTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPFLFS 209 >SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 919 Score = 35.9 bits (79), Expect = 0.011 Identities = 19/40 (47%), Positives = 22/40 (55%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V V G +S L GVPQG G F S Sbjct: 770 LTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPFLFS 809 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 35.5 bits (78), Expect = 0.014 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSG-SFFI 179 +TS+LS R Q V V G SS T + GVPQG G FF+ Sbjct: 187 ITSFLSVRTQFVSVNGTHSSCTPVTSGVPQGSVLGPGFFL 226 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP FL++IN +C Sbjct: 216 QGSVLGPGFFLLFINDITLC 235 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 34.7 bits (76), Expect = 0.025 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +TS+LS R Q V V G SS T + GVPQG Sbjct: 504 ITSFLSVRTQFVSVNGTHSSCTPVTSGVPQG 534 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 533 QGSVLGPALFLLFINDITLC 552 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 34.7 bits (76), Expect = 0.025 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +TS+LS R Q V V G SS T + GVPQG Sbjct: 75 ITSFLSVRTQFVSVNGTHSSCTPVTSGVPQG 105 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 104 QGSVLGPALFLLFINDITLC 123 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 34.7 bits (76), Expect = 0.025 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +TS+LS R Q V V G SS T + GVPQG Sbjct: 31 ITSFLSVRTQFVSVNGTHSSCTPVTSGVPQG 61 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 60 QGSVLGPALFLLFINDITLC 79 >SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 34.7 bits (76), Expect = 0.025 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 452 SYLTGRTQQVPIDGVLSSSQPLRYGVPQGSVLGPLLFS 489 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 34.7 bits (76), Expect = 0.025 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +TS+LS R Q V V G SS T + GVPQG Sbjct: 221 ITSFLSVRTQFVSVNGTHSSCTPVTSGVPQG 251 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 250 QGSVLGPALFLLFINDITLC 269 >SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) Length = 899 Score = 33.9 bits (74), Expect = 0.044 Identities = 19/42 (45%), Positives = 22/42 (52%) Frame = +3 Query: 57 K*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 K +TSYL+ R Q V V G +S L GVPQG G S Sbjct: 395 KWLTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPLLFS 436 >SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) Length = 236 Score = 33.9 bits (74), Expect = 0.044 Identities = 20/45 (44%), Positives = 24/45 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIYKL 197 +TSYL+ R Q V V G +S L GVPQG G S IY + Sbjct: 168 LTSYLTDRAQRVVVDGQQSDRCSLSFGVPQGSCLGPLLFS-IYAI 211 >SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 33.9 bits (74), Expect = 0.044 Identities = 19/42 (45%), Positives = 22/42 (52%) Frame = +3 Query: 57 K*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 K +TSYL+ R Q V V G +S L GVPQG G S Sbjct: 166 KWLTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPLLFS 207 >SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) Length = 979 Score = 33.9 bits (74), Expect = 0.044 Identities = 20/45 (44%), Positives = 24/45 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIYKL 197 +TSYL+ R Q V V G +S L GVPQG G S IY + Sbjct: 633 LTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPLLFS-IYAI 676 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 169 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 206 >SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24) Length = 1039 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V V G +S L GVPQG G S Sbjct: 231 LTSYLTDRAQRVVVDGQQSDRCSLSFGVPQGSCLGPLLFS 270 >SB_15983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.058 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R+Q V V G +S GVPQG G S Sbjct: 44 LTSYLTDRVQRVVVDGKQSDRCSFSFGVPQGSCLGPLLFS 83 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 318 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 355 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 384 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 421 >SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 203 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 240 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 203 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 240 >SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) Length = 367 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V V G +S L GVPQG G S Sbjct: 277 LTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPLLFS 316 >SB_44569| Best HMM Match : Gal_Lectin (HMM E-Value=4.5) Length = 162 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V V G +S L GVPQG G S Sbjct: 44 LTSYLTDRAQRVVVDGQQSDRCSLSFGVPQGSCLGPLLFS 83 >SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 630 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 292 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 329 >SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) Length = 385 Score = 33.5 bits (73), Expect = 0.058 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQG G S Sbjct: 62 SYLTGRTQQVLIDGVLSSSQPLRYGVPQGSVLGPLLFS 99 >SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) Length = 773 Score = 33.1 bits (72), Expect = 0.077 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GRIQ V + G SS L+ GVPQ G S Sbjct: 460 SYLTGRIQQVLIDGVLSSSQPLRYGVPQSSVLGPLLFS 497 >SB_33763| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) Length = 271 Score = 33.1 bits (72), Expect = 0.077 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSG----SFFISNIYKLL 200 +TSYL+ R Q V V G +S L GVPQG G S + S +++++ Sbjct: 138 LTSYLTDRAQRVVVDGKQSDRCSLSFGVPQGSCLGPLPFSIYASKLFEVI 187 >SB_29413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.1 bits (72), Expect = 0.077 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 MV W + +YL GR Q V V G S L GVPQG Sbjct: 35 MVAW--LHNYLQGRTQRVSVNGTFSCWLTLSSGVPQG 69 >SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) Length = 657 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSYLSGR Q V +G S L+ GVPQG Sbjct: 312 TSYLSGRSQRVLFEGVTSDSFDLRFGVPQG 341 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 33.1 bits (72), Expect = 0.077 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCINLC*KTIDIVTNIMSFNLLSC*NNQLIFYPSSPNLIY 330 + SILGP +F+++IN + + D T + S + + N ++YPSSP LI Sbjct: 804 QSSILGPLMFILFINDLPLEVSNSALEMNADDTTQVASGSSVKI--NWSLWYPSSPTLIV 861 Query: 331 I 333 + Sbjct: 862 L 862 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 1766 QGSVLGPTLFLLYIN 1780 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL++IN Sbjct: 1959 QGTVLGPILFLMFIN 1973 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSYLSGR Q V +G S L+ GVPQG Sbjct: 662 TSYLSGRSQRVLFEGVTSDSFDLRFGVPQG 691 >SB_50448| Best HMM Match : RVT_1 (HMM E-Value=3.7) Length = 390 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSYLSGR Q V +G S L+ GVPQG Sbjct: 45 TSYLSGRSQRVLFEGVTSDSFDLRFGVPQG 74 >SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) Length = 457 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 SYLSGR Q KG S+ + +GVPQG G F Sbjct: 285 SYLSGRTQKTCFKGVLSNALPINVGVPQGSILGPLF 320 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP FL++IN Sbjct: 312 QGSILGPLFFLLFIN 326 >SB_5801| Best HMM Match : UvdE (HMM E-Value=2.2) Length = 255 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSYLSGR Q V +G S L+ GVPQG Sbjct: 13 TSYLSGRSQRVLFEGVTSDSFDLRFGVPQG 42 >SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) Length = 904 Score = 32.7 bits (71), Expect = 0.10 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 SYLS R Q V V G SS + GVPQG G F Sbjct: 457 SYLSSRRQVVQVDGEVSSEMKINHGVPQGSILGPLF 492 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP FL++IN Sbjct: 484 QGSILGPLFFLLFIN 498 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 32.7 bits (71), Expect = 0.10 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 T+YL+ R Q VD+ G RSS + G+PQG Sbjct: 1494 TNYLTDRKQYVDLGGARSSELTMLCGIPQG 1523 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS LGP LFLIYIN Sbjct: 1522 QGSTLGPLLFLIYIN 1536 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 31.9 bits (69), Expect = 0.18 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GRIQ V + G SS L+ GV QG G S Sbjct: 581 SYLTGRIQQVLIDGVLSSSQPLRYGVRQGSVLGPLLFS 618 >SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) Length = 426 Score = 31.9 bits (69), Expect = 0.18 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 VTSYL+GR Q V + S + +GVPQG G + + N+Y Sbjct: 83 VTSYLTGRKQFVQIDDKSSRLADVCLGVPQGSVLG-YVLFNLY 124 >SB_40446| Best HMM Match : RVT_1 (HMM E-Value=2.2e-16) Length = 260 Score = 31.9 bits (69), Expect = 0.18 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q + G SS L+ GVPQG G S Sbjct: 83 SYLTGRTQQALIDGVLSSSQPLRYGVPQGSVLGPLLFS 120 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 31.9 bits (69), Expect = 0.18 Identities = 18/38 (47%), Positives = 21/38 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GRIQ V + G SS L+ GV QG G S Sbjct: 580 SYLTGRIQQVLIDGVLSSSQPLRYGVRQGSVLGPLLFS 617 >SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 820 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 849 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LF+IYIN C I Sbjct: 848 QGSVLGPLLFIIYINDFHRCSSI 870 >SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) Length = 1047 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 919 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 948 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 947 QGSVLGPLLFLIYINDFHRCSSI 969 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 573 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 602 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 601 QGSVLGPLLFLIYINDFHRCSSI 623 >SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 872 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 769 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 798 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 135 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 134 QGSVLGPLLFLIYINDFHRCSSI 156 >SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) Length = 759 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 645 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 674 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 673 QGSVLGPLLFLIYINDFHRCSSI 695 >SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) Length = 468 Score = 31.9 bits (69), Expect = 0.18 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVPQG Sbjct: 375 SSYLSNRRQFVSVNNSESDEVVLTHGVPQG 404 Score = 31.1 bits (67), Expect = 0.31 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 +GS+LGP LFLIYIN C I Sbjct: 403 QGSVLGPLLFLIYINDFHRCSSI 425 >SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) Length = 674 Score = 31.5 bits (68), Expect = 0.23 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSF 173 SYL GR Q KG S+ + MGVPQG G F Sbjct: 314 SYLFGRTQKPCFKGVLSNALPINMGVPQGSIFGPF 348 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSI GPFLFL+ IN Sbjct: 341 QGSIFGPFLFLLLIN 355 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 31.5 bits (68), Expect = 0.23 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 + SYL+GR Q V G+ SS + GVPQG Sbjct: 324 IRSYLTGRSQKCFVNGDLSSPRPISCGVPQG 354 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+Y+N C Sbjct: 353 QGSILGPLRFLLYVNDLPNC 372 >SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 31.5 bits (68), Expect = 0.23 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = +1 Query: 151 RGSILGPFLFLIYIN-CCKICFCINL 225 +GS+LGP LFLIYIN C + +++ Sbjct: 413 QGSVLGPLLFLIYINDICSVSTALDI 438 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLS R Q V+ G S ++K GVPQG Sbjct: 386 SYLSDREQFVNFNGVSSCRKLVKCGVPQG 414 >SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 31.1 bits (67), Expect = 0.31 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 SYLSG Q KG S+ + +GVPQG G F Sbjct: 503 SYLSGHTQKTCFKGVLSNALPINVGVPQGSILGPLF 538 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP FL++IN Sbjct: 530 QGSILGPLFFLLFIN 544 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 31.1 bits (67), Expect = 0.31 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQ G S Sbjct: 585 SYLTGRTQQVLIDGVLSSSQPLRYGVPQSSVLGPLLFS 622 >SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) Length = 269 Score = 31.1 bits (67), Expect = 0.31 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +LG+ H + SYLSGR Q V + SS + + GVPQG Sbjct: 224 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPQG 265 >SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24) Length = 568 Score = 31.1 bits (67), Expect = 0.31 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQ G S Sbjct: 452 SYLTGRTQQVLIDGVLSSSQPLRYGVPQSSVLGPLLFS 489 >SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) Length = 1033 Score = 31.1 bits (67), Expect = 0.31 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL YIN +C Sbjct: 276 QGSVLGPLLFLAYINDLPLC 295 >SB_32049| Best HMM Match : RVT_1 (HMM E-Value=6.7e-15) Length = 716 Score = 31.1 bits (67), Expect = 0.31 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = +1 Query: 154 GSILGPFLFLIYIN 195 GS+LGPFLFL+Y+N Sbjct: 507 GSLLGPFLFLLYVN 520 >SB_23604| Best HMM Match : RVT_1 (HMM E-Value=4.6e-13) Length = 438 Score = 31.1 bits (67), Expect = 0.31 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQ G S Sbjct: 112 SYLTGRTQQVLIDGVLSSSQPLRYGVPQSSVLGPLLFS 149 >SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.1 bits (67), Expect = 0.31 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +LG+ H + SYLSGR Q V + SS + + GVPQG Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPQG 73 >SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.1 bits (67), Expect = 0.31 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S+ +V++ GVPQG Sbjct: 43 SYLRGRRQFVSIDGVDSNLSVIQHGVPQG 71 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 70 QGSILGPLLFVLFIN 84 >SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.1 bits (67), Expect = 0.31 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +LG+ H + SYLSGR Q V + SS + + GVPQG Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPQG 73 >SB_19280| Best HMM Match : RVT_1 (HMM E-Value=3.5e-12) Length = 347 Score = 31.1 bits (67), Expect = 0.31 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 SYL+GR Q V + G SS L+ GVPQ G S Sbjct: 83 SYLTGRTQQVLIDGVLSSSQPLRYGVPQSSVLGPLLFS 120 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 31.1 bits (67), Expect = 0.31 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLS R Q VD G+ SS + GVPQG Sbjct: 160 SYLSERQQFVDYSGHLSSCKYVNCGVPQG 188 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 151 RGSILGPFLFLIYIN-CCKICFCINL 225 +GS+LGP LF IYIN C + ++L Sbjct: 187 QGSVLGPLLFHIYINDLCNVSNALDL 212 >SB_15533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 31.1 bits (67), Expect = 0.31 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLSGR Q V +G S L+ GVPQG Sbjct: 601 SYLSGRSQRVLFEGVTSDSFDLRFGVPQG 629 >SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) Length = 214 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYLS R Q V V + S VL GVP+G Sbjct: 86 SSYLSNRRQFVSVNNSESDEVVLTHGVPEG 115 Score = 30.7 bits (66), Expect = 0.41 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +1 Query: 154 GSILGPFLFLIYINCCKICFCI 219 GS+LGP LFLIYIN C I Sbjct: 115 GSVLGPLLFLIYINDFHRCSSI 136 >SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 448 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 476 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 475 QGSILGPLLFVLFIN 489 >SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 393 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 421 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 420 QGSILGPLLFVLFIN 434 >SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) Length = 471 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 375 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 403 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 402 QGSILGPLLFVLFIN 416 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 243 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 271 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 270 QGSILGPLLFVLFIN 284 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 19 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 47 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 46 QGSILGPLLFVLFIN 60 >SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 37 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 65 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 64 QGSILGPLLFVLFIN 78 >SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL+GR Q V V+G +S L GVP+G Sbjct: 65 SYLNGRGQRVSVRGCQSEKLDLSCGVPKG 93 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 37 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 65 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 64 QGSILGPLLFVLFIN 78 >SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 592 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 620 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 619 QGSILGPLLFVLFIN 633 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 26 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 54 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 53 QGSILGPLLFVLFIN 67 >SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) Length = 1002 Score = 30.7 bits (66), Expect = 0.41 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 + SYL GR Q V + +SS + GVPQG Sbjct: 544 LASYLCGRQQHVQIDDRKSSSARAEFGVPQG 574 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 37 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 65 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 64 QGSILGPLLFVLFIN 78 >SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) Length = 258 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 162 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 190 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 189 QGSILGPLLFVLFIN 203 >SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) Length = 548 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 375 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 403 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 402 QGSILGPLLFVLFIN 416 >SB_18998| Best HMM Match : Exo_endo_phos (HMM E-Value=1.1e-10) Length = 422 Score = 30.7 bits (66), Expect = 0.41 Identities = 13/21 (61%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = +1 Query: 136 KWVYLR-GSILGPFLFLIYIN 195 K +YLR G++LGP +FL+YIN Sbjct: 242 KSLYLRKGTVLGPLMFLLYIN 262 >SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) Length = 263 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 128 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 156 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 155 QGSILGPLLFVLFIN 169 >SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 30.7 bits (66), Expect = 0.41 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHS 164 +LG+ H + SYLSGR Q V + SS + + GVP G +S Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPPGINS 76 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVPQG Sbjct: 540 SYLRGRRQFVSIDGVDSDLSVIQHGVPQG 568 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+++IN Sbjct: 567 QGSILGPLLFVLFIN 581 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 737 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 771 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 770 QGTVLGPLLFLLYVN 784 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 205 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 235 Score = 26.2 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL++IN Sbjct: 234 QGTVLGPLMFLLFIN 248 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 43 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 77 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 76 QGTVLGPLLFLLYVN 90 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 62 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 92 Score = 26.2 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL++IN Sbjct: 91 QGTVLGPLMFLLFIN 105 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 139 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 173 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 172 QGTVLGPLLFLLYVN 186 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 690 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 720 Score = 26.2 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL++IN Sbjct: 719 QGTVLGPLMFLLFIN 733 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 275 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 309 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 308 QGTVLGPLLFLLYVN 322 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 459 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 493 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 492 QGTVLGPLLFLLYVN 506 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 30.3 bits (65), Expect = 0.54 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 VTSYL+GR Q V + S + +GVPQG G + N+Y Sbjct: 841 VTSYLTGRKQFVQIDDKSSRLADVCLGVPQGSVLGP-VLFNLY 882 Score = 26.2 bits (55), Expect = 8.8 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LF +Y+N Sbjct: 870 QGSVLGPVLFNLYVN 884 >SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) Length = 231 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 SYL+GR Q V + G SS L+ GVPQ Sbjct: 203 SYLTGRTQQVLIDGVLSSSQPLRYGVPQ 230 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 249 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 283 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 282 QGTVLGPLLFLLYVN 296 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 615 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 649 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 648 QGTVLGPLLFLLYVN 662 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 451 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 485 Score = 27.5 bits (58), Expect = 3.8 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 484 QGTVLGPLLFLLYMN 498 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 1059 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 1089 Score = 26.2 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL++IN Sbjct: 1088 QGTVLGPLMFLLFIN 1102 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 334 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 368 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 367 QGTVLGPLLFLLYVN 381 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 179 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 209 Score = 26.2 bits (55), Expect = 8.8 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL++IN Sbjct: 208 QGTVLGPLMFLLFIN 222 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 30.3 bits (65), Expect = 0.54 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 45 MVHWK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +++W S+L R QTV G RS +++ GVPQG Sbjct: 267 LLYW--FMSFLRNRTQTVVCDGKRSCPSLVTSGVPQG 301 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 300 QGTVLGPLLFLLYVN 314 >SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 229 Score = 30.3 bits (65), Expect = 0.54 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 VTSYL+GR Q V + S + +GVPQG G + N+Y Sbjct: 83 VTSYLTGRKQFVQIDDKSSRLADVCLGVPQGSVLGP-VLFNLY 124 Score = 26.2 bits (55), Expect = 8.8 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LF +Y+N Sbjct: 112 QGSVLGPVLFNLYVN 126 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 30.3 bits (65), Expect = 0.54 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 V S+L R QTV V+G S T + GVPQG Sbjct: 488 VRSWLIHRNQTVVVEGETSKSTRVTSGVPQG 518 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 712 QGSLLGPLLFLVYIN 726 Score = 28.3 bits (60), Expect = 2.2 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 T YLS R Q V+G SS + GVPQG Sbjct: 684 THYLSDRTQCTVVQGATSSPLPVLSGVPQG 713 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 410 QGSILGPLLFVIYIN 424 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 303 QGSLLGPLLFLVYIN 317 Score = 28.3 bits (60), Expect = 2.2 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 T YLS R Q V+G SS + GVPQG Sbjct: 275 THYLSDRTQCTVVQGATSSPLPVLSGVPQG 304 >SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) Length = 208 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 72 QGSILGPLLFVIYIN 86 >SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 181 QGSLLGPLLFLVYIN 195 >SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 973 Score = 29.9 bits (64), Expect = 0.72 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 SYL+GR Q V V+G +S L GVPQ Sbjct: 852 SYLNGRGQLVSVRGCQSERLDLSCGVPQ 879 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 244 QGSILGPLLFVIYIN 258 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN + C Sbjct: 327 QGSILGPLFFLLYINDLQEC 346 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 298 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 335 >SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 171 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 72 QGSILGPLLFVIYIN 86 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 542 QGSILGPLLFVIYIN 556 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 11 QGSVLGPALFLLFINDITLC 30 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFLIY+N Sbjct: 149 QGSILGPLLFLIYMN 163 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYL+ R QT ++K S + + GVPQG Sbjct: 121 SSYLTNRKQTTEIKNCISEKSSITCGVPQG 150 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 292 QGSILGPLLFVIYIN 306 >SB_9873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 21 QGSILGPLLFVIYIN 35 >SB_8967| Best HMM Match : RVT_1 (HMM E-Value=7.6e-18) Length = 483 Score = 29.9 bits (64), Expect = 0.72 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LF+IYIN Sbjct: 380 QGSILGPLLFVIYIN 394 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP LFL++IN +C Sbjct: 266 QGSVLGPALFLLFINDITLC 285 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 400 QGSVLGPVLFLLYIN 414 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYL+ R Q + ++SS + + GVPQG Sbjct: 372 SSYLTNRKQFTQIGSSKSSLSSISYGVPQG 401 >SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 329 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIYKLL*NMFLYKFMLEND 239 + ++L+ R+Q V + G+ SS GVPQG + + L + + Y+ +D Sbjct: 142 IAAFLTARLQRVKISGHTSSPVFPNGGVPQGTKLAPLLFAILVNRLASTWPYRIKYVDD 200 >SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) Length = 232 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +G+ILGP LFL+YIN C Sbjct: 141 QGTILGPLLFLLYINDLPNC 160 >SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) Length = 193 Score = 29.5 bits (63), Expect = 0.95 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLS R Q V V G SS + GVPQG Sbjct: 67 SYLSNRRQRVTVLGFTSSEASVTSGVPQG 95 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 166 QGSVLGPVLFLLYIN 180 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYL+ R Q + ++SS + + GVPQG Sbjct: 138 SSYLTNRKQFTQIGSSKSSLSSISYGVPQG 167 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVPQ Sbjct: 453 SSYLSNRRQFVSVNNSESDEVVLTHGVPQ 481 >SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) Length = 382 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 300 QGSVLGPVLFLLYIN 314 >SB_5866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 0.95 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSG----SFFISNIYKLL*NMFLYKF 224 +TS+L R Q V V G +S + GVPQG G S ++NI N L K+ Sbjct: 40 ITSFLCDRQQRVVVDGMATSFLGISRGVPQGTVLGQLLFSIVVNNIQPASANSLLIKY 97 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 29.5 bits (63), Expect = 0.95 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 154 GSILGPFLFLIYINCCKIC 210 GSILGP FLIYIN C Sbjct: 664 GSILGPLFFLIYINDLPQC 682 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL++IN Sbjct: 1689 QGTVLGPILFLMFIN 1703 >SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) Length = 710 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIYKLL*NMFLYKFMLEND 239 + ++L+ R+Q V + G+ SS GVPQG + + L + + Y+ +D Sbjct: 469 IAAFLTARLQRVKISGHTSSPVFPNGGVPQGTKLAPLLFAILVNRLASTWPYRIKYVDD 527 >SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 29.5 bits (63), Expect = 0.95 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 VTSYL+GR Q V + S + GVPQG G + N+Y Sbjct: 43 VTSYLTGRKQFVQIDDKSSRLADVCFGVPQGSVLGP-VLFNLY 84 Score = 26.2 bits (55), Expect = 8.8 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LF +Y+N Sbjct: 72 QGSVLGPVLFNLYVN 86 >SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVPQ Sbjct: 106 SSYLSNRRQFVSVNNSESDEVVLTHGVPQ 134 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 + S+LGP LFLIYIN C I Sbjct: 134 QSSVLGPLLFLIYINDFHRCSSI 156 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 166 QGSVLGPVLFLLYIN 180 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYL+ R Q + ++SS + + GVPQG Sbjct: 138 SSYLTNRKQFTQIGSSKSSLSSISYGVPQG 167 >SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) Length = 367 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVPQ Sbjct: 338 SSYLSNRRQFVSVNNSESDEVVLTHGVPQ 366 >SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) Length = 500 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVPQ Sbjct: 471 SSYLSNRRQFVSVNNSESDEVVLTHGVPQ 499 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 367 QGSVLGPTLFLLYIN 381 >SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12) Length = 355 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TS+L R Q V V G +S + GVPQG G S Sbjct: 269 ITSFLCDRQQRVVVDGMATSSLGISRGVPQGTVLGPLLFS 308 >SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2033 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 154 GSILGPFLFLIYINCCKIC 210 G+ILGP LFL+YIN C Sbjct: 1028 GTILGPLLFLLYINDLPNC 1046 >SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) Length = 347 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 15 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 52 >SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 >SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) Length = 347 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 15 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 52 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 95 QGSVLGPTLFLLYIN 109 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 205 QGSVLGPTLFLLYIN 219 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 327 QGSILGPLFFLLYINDLPEC 346 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 298 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 335 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 153 QGSILGPLFFLLYINDLPEC 172 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 124 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 161 >SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 328 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 >SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 15 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 52 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 571 QGSILGPLFFLLYINDLPEC 590 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 542 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 579 >SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) Length = 208 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 228 QGSVLGPTLFLLYIN 242 >SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +SYL+ R Q ++ ++SS + + GVPQG Sbjct: 298 SSYLTNRKQFTQIRSSKSSLSSISYGVPQG 327 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 794 QGSVLGPTLFLLYIN 808 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 637 QGSILGPLFFLLYINDLPEC 656 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 608 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 645 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 72 QGSILGPLFFLLYINDLPEC 91 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 43 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 80 >SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) Length = 715 Score = 29.1 bits (62), Expect = 1.3 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL+GR Q V + G SS + GVPQG Sbjct: 598 SYLTGRRQRVVLDGASSSWLPVTSGVPQG 626 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFL+Y N Sbjct: 625 QGSILGPLLFLVYAN 639 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 201 QGSVLGPTLFLLYIN 215 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + ++ G+PQG G F Sbjct: 1489 IQSYLSNRKQKCQLNSTVSSESKIQCGIPQGSILGPLF 1526 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 1518 QGSILGPLFFLLYINDLPEC 1537 >SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) Length = 347 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 15 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 52 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 147 QGSVLGPTLFLLYIN 161 >SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 44 QGSILGPLFFLLYINDLPEC 63 >SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 154 GSILGPFLFLIYINCCKIC 210 G+ILGP LFL+YIN C Sbjct: 254 GTILGPLLFLLYINDLPNC 272 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL+YIN Sbjct: 228 QGSVLGPTLFLLYIN 242 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 377 QGSILGPLFFLLYINDLPEC 396 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 348 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGPLF 385 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 57 K*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 K + SYL+GRIQ V G S + G+PQ Sbjct: 579 KTIQSYLTGRIQRVRCNGVMSDWLEIHCGIPQ 610 >SB_51005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS++GP LFL+YIN Sbjct: 4 QGSVVGPLLFLLYIN 18 >SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) Length = 520 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + +GVPQG Sbjct: 364 SYLEDRKQKVTISGQLSDSQPITVGVPQG 392 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 391 QGSILGPLMFILFIN 405 >SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) Length = 304 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFL+Y N Sbjct: 276 QGSILGPLLFLVYAN 290 Score = 27.1 bits (57), Expect = 5.1 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 72 YLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 YL+GR Q V + G SS + GVPQG Sbjct: 250 YLTGRRQRVVLDGVSSSWLSVTSGVPQG 277 >SB_40349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +LG+ H + SYLSGR Q V + SS + + GVPQ Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPQ 72 >SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) Length = 1311 Score = 28.7 bits (61), Expect = 1.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V G +S L GVP G G S Sbjct: 619 LTSYLTDRAQRFVVDGKQSDRCSLSFGVPLGSCLGPLLFS 658 >SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) Length = 396 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFCI 219 + S+LGP LFLIYIN C I Sbjct: 134 QSSVLGPLLFLIYINDFHRCSSI 156 Score = 28.3 bits (60), Expect = 2.2 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVPQ Sbjct: 106 SSYLSNRRQFVSVINSESDEVVLTHGVPQ 134 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FLIYIN Sbjct: 371 QGTVLGPLMFLIYIN 385 >SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) Length = 556 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 + +YL+ R Q V + +S ++ GVPQG G I N+Y Sbjct: 189 IVNYLTDRKQMVQIDDRKSDMETVEFGVPQGSILGP-VIFNLY 230 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 28.7 bits (61), Expect = 1.7 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLS R Q V V G SS + GVPQG Sbjct: 1673 SYLSNRRQRVIVLGCTSSEASVTSGVPQG 1701 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP +FL+Y N Sbjct: 1700 QGSLLGPIIFLLYAN 1714 >SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL GR Q V + G S +V++ GVP G Sbjct: 771 SYLRGRRQFVSIDGVDSDLSVIQHGVPSG 799 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +1 Query: 154 GSILGPFLFLIYIN 195 GSILGP LF+++IN Sbjct: 799 GSILGPLLFVLFIN 812 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFL+Y N Sbjct: 482 QGSILGPLLFLVYAN 496 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 RGSILGP +F+++IN Sbjct: 72 RGSILGPLMFILFIN 86 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVP+G Sbjct: 45 SYLEDRKQKVTISGQLSDSQPITAGVPRG 73 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 RGSILGP +F+++IN Sbjct: 688 RGSILGPLMFILFIN 702 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + +GVP+G Sbjct: 661 SYLEDRKQKVTISGQLSDSQPITVGVPRG 689 >SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 1.7 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +LG+ H + SYLSGR Q V + SS + + GVPQ Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVPQ 72 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 28.7 bits (61), Expect = 1.7 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYLS R Q V V G SS + GVPQG Sbjct: 1624 SYLSNRRQRVIVLGCTSSEASVTSGVPQG 1652 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP +FL+Y N Sbjct: 1651 QGSLLGPIIFLLYAN 1665 >SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 861 Score = 28.7 bits (61), Expect = 1.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFIS 182 +TSYL+ R Q V G +S L GVP G G S Sbjct: 633 LTSYLTDRAQRFVVDGKQSDRCSLSFGVPLGSCLGPLLFS 672 >SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS++GP LFL+YIN Sbjct: 491 QGSVVGPLLFLLYIN 505 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 148 LRGSILGPFLFLIYIN 195 L+G++LGP LFL++IN Sbjct: 3 LQGTVLGPILFLLFIN 18 >SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 822 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFL+Y N Sbjct: 619 QGSILGPLLFLVYAN 633 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 151 RGSILGPFLFLIYI 192 +GSILGP LFLIYI Sbjct: 80 QGSILGPLLFLIYI 93 Score = 26.6 bits (56), Expect = 6.7 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGS-FFISNIYKL 197 SYLS R Q V + S + GVPQG G F+ IY L Sbjct: 53 SYLSNRKQQCMVNWHLSKPRTITCGVPQGSILGPLLFLIYIYDL 96 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS++GP LFL+YIN Sbjct: 90 QGSVVGPLLFLLYIN 104 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS++GP LFL+YIN Sbjct: 297 QGSVVGPLLFLLYIN 311 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQGF 158 +SYL+ R Q + ++SS + + GVPQG+ Sbjct: 349 SSYLTNRKQFTQIGSSKSSLSSISYGVPQGY 379 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 124 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGQLF 161 >SB_7145| Best HMM Match : RVT_1 (HMM E-Value=3.8e-25) Length = 455 Score = 28.7 bits (61), Expect = 1.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP LFL+Y N Sbjct: 281 QGSILGPLLFLVYAN 295 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 RGSILGP +F+++IN Sbjct: 470 RGSILGPLMFILFIN 484 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + +GVP+G Sbjct: 443 SYLEDRKQKVTISGQLSDSQPITVGVPRG 471 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +1 Query: 157 SILGPFLFLIYIN 195 S+LGPFLFL+Y+N Sbjct: 2209 SLLGPFLFLLYVN 2221 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFF 176 + SYLS R Q + SS + + G+PQG G F Sbjct: 805 IQSYLSNRKQKCQLNSTVSSESKITCGIPQGSILGQLF 842 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 28.3 bits (60), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP LFL+Y+N Sbjct: 62 QGTVLGPLLFLLYVN 76 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 28.3 bits (60), Expect = 2.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +1 Query: 154 GSILGPFLFLIYIN 195 GS++GP LFL+YIN Sbjct: 700 GSVVGPLLFLLYIN 713 >SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 28.3 bits (60), Expect = 2.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 57 K*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 K + SYL+GR Q V G S + G+PQ G F NI+ Sbjct: 162 KTIQSYLTGRFQRVRCNGAVSDWLEIHCGIPQRSLLGPLFF-NIF 205 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 28.3 bits (60), Expect = 2.2 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSG-SFFISNIYKL 197 + SYLS R Q + SS + + G+PQG G FF+ I L Sbjct: 85 IQSYLSNRKQKCQINSTVSSESKITCGIPQGSILGPPFFLLYINDL 130 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GSILGP FL+YIN C Sbjct: 114 QGSILGPPFFLLYINDLPEC 133 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVP 149 SYL+GR Q V + G SS L+ GVP Sbjct: 203 SYLTGRTQQVLIDGVLSSSQPLRYGVP 229 >SB_23576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 +SYLS R Q V V + S VL GVP+ Sbjct: 50 SSYLSNRRQFVSVNNSESDEVVLTHGVPE 78 >SB_22310| Best HMM Match : Exo_endo_phos (HMM E-Value=0.12) Length = 633 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQ 152 SYL R Q V + G RS L+ GVPQ Sbjct: 606 SYLKDRTQFVMINGVRSMSKELRYGVPQ 633 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 671 QGTVLGPLMFLLYIN 685 >SB_49551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 157 SILGPFLFLIYIN 195 SILGP LFLIY+N Sbjct: 74 SILGPLLFLIYVN 86 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 118 QGSVLGPVLFLLFIN 132 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 118 QGSVLGPVLFLLFIN 132 >SB_39823| Best HMM Match : HECT (HMM E-Value=4.5) Length = 289 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 61 QGSVSGPYLFNIFINDLEINLC 82 >SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083) Length = 497 Score = 27.9 bits (59), Expect = 2.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFI 179 +SYL+ R Q + ++SS + + GVPQG G + I Sbjct: 266 SSYLTNRKQFTQIGSSKSSLSSISYGVPQGSVLGPWAI 303 >SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 20 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 49 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 48 QGSILGPILFVLFANDLPDSVCSC 71 >SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) Length = 1423 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 1053 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 1082 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 1081 QGSILGPILFVLFANDLPDSVCSC 1104 >SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 665 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 694 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 693 QGSILGPILFVLFANDLPDSVCSC 716 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 45 SYLEDRKQKVTISGQLSDSQPITAGVPQG 73 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 72 QGSILGPLMFILFIN 86 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 34 QGSVLGPVLFLLFIN 48 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 210 SYLEDRKQKVTISGQLSDSQPITAGVPQG 238 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 237 QGSILGPLMFILFIN 251 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 432 QGSVLGPVLFLLFIN 446 >SB_31422| Best HMM Match : RVT_1 (HMM E-Value=1) Length = 374 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 326 QGSVSGPYLFNIFINDLEINLC 347 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 210 SYLEDRKQKVTISGQLSDSQPITAGVPQG 238 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 237 QGSILGPLMFILFIN 251 >SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKIC 210 +GS+LGP FL++IN +C Sbjct: 11 QGSVLGPGFFLLFINDITLC 30 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 118 QGSVLGPVLFLLFIN 132 >SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) Length = 1421 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 1212 QGSVSGPYLFNIFINDLEINLC 1233 >SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 2.9 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 36 VLGMVH--WK*VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 +LG+ H + SYLSGR Q V + SS + + GV QG Sbjct: 32 ILGISHDALSLIKSYLSGRKQVCQVNESLSSESHITCGVSQG 73 >SB_20861| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) Length = 370 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 116 QGSVSGPYLFNIFINDLEINLC 137 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 204 QGTVLGPLMFLLYIN 218 >SB_17711| Best HMM Match : HECT (HMM E-Value=4.9) Length = 310 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 56 QGSVSGPYLFNIFINDLEINLC 77 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 562 QGSVLGPVLFLLFIN 576 >SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 131 SYLEDRKQKVTISGQLSDSQPITAGVPQG 159 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 158 QGSILGPLMFILFIN 172 >SB_7771| Best HMM Match : RVT_1 (HMM E-Value=5.3e-13) Length = 384 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 152 QGSVSGPYLFNIFINDLEINLC 173 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 24 SYLEDRKQKVTISGQLSDSQPITAGVPQG 52 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 51 QGSILGPLMFILFIN 65 >SB_6517| Best HMM Match : RVT_1 (HMM E-Value=2.3) Length = 275 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 227 QGSVSGPYLFNIFINDLEINLC 248 >SB_2508| Best HMM Match : RVT_1 (HMM E-Value=1e-05) Length = 525 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +1 Query: 157 SILGPFLFLIYIN 195 SILGP LFLIY+N Sbjct: 416 SILGPLLFLIYVN 428 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 296 SYLEDRKQKVTISGQLSDSQPITAGVPQG 324 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 323 QGSILGPLMFILFIN 337 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 231 QGSVLGPVLFLLFIN 245 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 624 SYLEDRKQKVTISGQLSDSQPITAGVPQG 652 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 651 QGSILGPLMFILFIN 665 >SB_57918| Best HMM Match : RVT_1 (HMM E-Value=1.1e-28) Length = 395 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 195 QGSVSGPYLFNIFINDLEINLC 216 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 289 QGTVLGPLMFLLYIN 303 >SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) Length = 264 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 109 QGTVLGPLMFLLYIN 123 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 109 QGTVLGPLMFLLYIN 123 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 594 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 623 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 622 QGSILGPILFVLFANDLPDSVCSC 645 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 34 QGSVLGPVLFLLFIN 48 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 639 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 668 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 667 QGSILGPILFVLFANDLPDSVCSC 690 >SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) Length = 265 Score = 27.9 bits (59), Expect = 2.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 + +YL+ R Q V + +S ++ GVPQG G I N+Y Sbjct: 141 MVNYLTDRKQMVQIDDRKSDMETVEFGVPQGSILGP-VIFNLY 182 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 210 SYLEDRKQKVTISGQLSDSQPITAGVPQG 238 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 237 QGSILGPLMFILFIN 251 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 788 QGTVLGPLMFLLYIN 802 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 69 SYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 SYL R Q V + G S + GVPQG Sbjct: 45 SYLEDRKQKVTISGQLSDSQPITAGVPQG 73 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GSILGP +F+++IN Sbjct: 72 QGSILGPLMFILFIN 86 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 532 QGSVLGPVLFLLFIN 546 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 66 TSYLSGRIQTVDVKGNRSSGTVLKMGVPQG 155 TSY++ R Q V + G S+ + GVPQG Sbjct: 542 TSYITNRSQRVAIPGGVSTCQPVTSGVPQG 571 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +1 Query: 151 RGSILGPFLFLIYINCC--KICFC 216 +GSILGP LF+++ N +C C Sbjct: 570 QGSILGPILFVLFANDLPDSVCSC 593 >SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 151 RGSILGPFLFLIYINCCKICFC 216 +GS+ GP+LF I+IN +I C Sbjct: 374 QGSVSGPYLFNIFINDLEINLC 395 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 244 QGTVLGPLMFLLYIN 258 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 60 QGSVLGPVLFLLFIN 74 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +GS+LGP LFL++IN Sbjct: 329 QGSVLGPVLFLLFIN 343 >SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) Length = 264 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 151 RGSILGPFLFLIYIN 195 +G++LGP +FL+YIN Sbjct: 109 QGTVLGPLMFLLYIN 123 >SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 27.9 bits (59), Expect = 2.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 63 VTSYLSGRIQTVDVKGNRSSGTVLKMGVPQGFHSGSFFISNIY 191 + +YL+ R Q V + +S ++ GVPQG G I N+Y Sbjct: 120 MVNYLTDRKQMVQIDDRKSDMETVEFGVPQGSILGP-VIFNLY 161 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,463,841 Number of Sequences: 59808 Number of extensions: 229100 Number of successful extensions: 986 Number of sequences better than 10.0: 356 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -