BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0431 (545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 1.3 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 1.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.3 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 5.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.3 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 7.0 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 7.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 9.3 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.4 bits (48), Expect = 1.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 149 PLR*RVNL*AILQ*ELPQMFAFSHRIMVLCMNFHRAFNYSAYI 21 PL L I+Q + F+F R LC+ F+ F Y +YI Sbjct: 54 PLTLLYKLLGIIQFPISAHFSFMSRF--LCLPFYSYFFYLSYI 94 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.4 bits (48), Expect = 1.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 149 PLR*RVNL*AILQ*ELPQMFAFSHRIMVLCMNFHRAFNYSAYI 21 PL L I+Q + F+F R LC+ F+ F Y +YI Sbjct: 10 PLTLLYKLLGIIQFPISAHFSFMSRF--LCLPFYSYFFYLSYI 50 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 68 PLYDGRTQTSVATP 109 PLY G SVATP Sbjct: 494 PLYSGNLAVSVATP 507 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.4 bits (43), Expect = 5.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 159 TNIAIAKCLDMPVNSINIIVRRLGGG 236 T AIA LD NI+V LGGG Sbjct: 5 TAAAIAYGLDKKGAEQNILVYDLGGG 30 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 212 DVDTINGHIQTFCDCYV 162 D+D + G + T C C+V Sbjct: 191 DLDVVKGAMLTNCICFV 207 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 212 DVDTINGHIQTFCDCYV 162 D+D + G + T C C+V Sbjct: 191 DLDVVKGAMLTNCICFV 207 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 212 DVDTINGHIQTFCDCYV 162 D+D + G + T C C+V Sbjct: 191 DLDVVKGAMLTNCICFV 207 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 212 DVDTINGHIQTFCDCYV 162 D+D + G + T C C+V Sbjct: 191 DLDVVKGAMLTNCICFV 207 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = +3 Query: 144 QWLDLTNIAIAKCLDMPVNSINIIVRRLGGGYGSKITRASQIACAAACVTRFL 302 ++LD+ IAK + V + N+ GG+ SQ+A AA F+ Sbjct: 74 EYLDVDAGTIAKLNALKVKNPNLKTLIAIGGWNEGSETYSQVAADAAKRATFI 126 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.0 bits (42), Expect = 7.0 Identities = 13/55 (23%), Positives = 28/55 (50%) Frame = +1 Query: 301 LGVLVDLSYRYKLI*KL*ANVYLPIVSLRLA*TKLVEFKISKIHFIKTVDVPLMK 465 L VL+D + Y +I N+Y I+ L K+V+ + +++ + + +M+ Sbjct: 154 LSVLIDNNMSYIIIVSFATNLYFIIIQL-FGSMKIVKGTLKTAYYLISFALLIMR 207 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 273 CAAACVTRFLGRTCRFILPLQ 335 CA CV + TCR+ L+ Sbjct: 44 CARKCVKDSVPMTCRYTFLLE 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,355 Number of Sequences: 336 Number of extensions: 2788 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -