BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0431 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 69 8e-14 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 1.6 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 5.0 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 69.3 bits (162), Expect = 8e-14 Identities = 46/165 (27%), Positives = 78/165 (47%), Gaps = 2/165 (1%) Frame = +3 Query: 18 SDISTVIEGSMKIHAQYHYTMGERKHLWQLLLQDGLEIYSSTQWLDLTNIAIAKCLDMPV 197 S+ +IEG ++ Q H+ + + D +E+ SSTQ +A+ L +P Sbjct: 716 SEADVIIEGDCRMGGQEHFYLETQACSAVPKDSDEIEVISSTQHPTEIQHHVAQTLGIPA 775 Query: 198 NSINIIVRRLGGGYGSKITRASQIACAAACVTRFLGRTCRFILPLQTNMKAIGKRIPTNC 377 + + V+RLGGG+G K +RA+ +A A +GR R +L +M G R P Sbjct: 776 SKVVSRVKRLGGGFGGKESRAAIVAIPVALAAHRMGRPVRCMLDRDEDMAVSGTRHPFYF 835 Query: 378 EFEIGVNKAGRIQNLKNTFYQDGGCSFNEVLTPL--TVKHFQNCY 506 +++GV+K ++ Y + G S + L ++ H QN Y Sbjct: 836 HYKVGVSKDDKLLAGDFRAYNNAGHSMDLSFAVLERSMFHIQNAY 880 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 449 STVLIKCIFEILNSTSFVYANLKLTIGRYTF 357 +T+L+ CI I+ +T V + + G YTF Sbjct: 160 TTILVNCILMIMPTTPTVESTEVIFTGIYTF 190 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 232 PPNRRTMMLILLTGISKHF 176 PP+R TM LI GIS F Sbjct: 65 PPDRDTMCLIRCIGISLDF 83 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,939 Number of Sequences: 2352 Number of extensions: 12208 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -