BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0431 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.7 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 4.7 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.7 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 21 6.2 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 2.0 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +3 Query: 351 IGKRIPTNCEFEIGVNKAGRIQNLKNTFYQDGGCSFNEVLTP 476 +G ++P C F VN A R++ S E+L+P Sbjct: 531 VGLKMPRYCLFGDSVNTASRMEATSQAMQIHISQSTKELLSP 572 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +3 Query: 303 GRTCRFILPLQTNMK---AIGKRIPTNCEFEIGVNKAGRIQNL 422 G+ R + + T M +GK++P C F V A + ++L Sbjct: 578 GKPIRMRIGIHTGMVLAGVVGKKMPRYCLFGHNVTLANKFESL 620 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/41 (21%), Positives = 23/41 (56%) Frame = -1 Query: 473 GEDFIKGTSTVLIKCIFEILNSTSFVYANLKLTIGRYTFAY 351 G F+ GT+T+ + + +++ + A+++ +G + F Y Sbjct: 166 GGGFMSGTATLDVYNADIMAATSNVIIASMQYRVGAFGFLY 206 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/41 (21%), Positives = 23/41 (56%) Frame = -1 Query: 473 GEDFIKGTSTVLIKCIFEILNSTSFVYANLKLTIGRYTFAY 351 G F+ GT+T+ + + +++ + A+++ +G + F Y Sbjct: 166 GGGFMSGTATLDVYNADIMAATSNVIIASMQYRVGAFGFLY 206 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 300 LGRTCRFILPLQTNMKAIGKRIPTNCEFEIGVNKAGRI 413 LG+ R + ++MK++G+ + +FE KA R+ Sbjct: 189 LGKFHRVCTQIGSSMKSVGEVMAIGRKFEEAFQKALRM 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,960 Number of Sequences: 438 Number of extensions: 3328 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -