BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0429 (574 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosa... 28 1.1 SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 25 7.9 >SPAC23A1.12c |||phenylalanine-tRNA ligase beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 27.9 bits (59), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 94 TLFRFYLLLPFHISLINVIKY*YALTQLLENSYTSSANASLDFMNIASFIS 246 T+F Y PF I +N+I T++ N + A +D++N A +S Sbjct: 259 TMFSCYCEEPFTIEPVNIISEHNGCTRVTPNLNPTCFKADIDYLNEACGLS 309 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 25.0 bits (52), Expect = 7.9 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -1 Query: 448 DLVLILDLGLFFSQFVICINLYKFPRFFLF*NVGYLLVRII 326 D+++ LGL F + IN PRFFLF ++ +++ II Sbjct: 529 DMLIGFVLGLLLGIFRVYIN----PRFFLFDSLFEVIISII 565 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,996,475 Number of Sequences: 5004 Number of extensions: 37768 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -