BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0429 (574 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U10401-1|AAA19058.1| 131|Caenorhabditis elegans Hypothetical pr... 27 7.2 AC024090-3|AAK67220.3| 370|Caenorhabditis elegans Hypothetical ... 27 7.2 >U10401-1|AAA19058.1| 131|Caenorhabditis elegans Hypothetical protein T20B12.5 protein. Length = 131 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -3 Query: 359 LKCRLFVSQNHF*KRLEFYNKI*KYVTYYGPLLNFTLELMKLAIFI 222 ++C LF +QN F +LE Y KY Y PLL + L L I + Sbjct: 81 IRCPLFHAQNIFNSKLEKYECTFKY--YSNPLLVNVIILFGLRISV 124 >AC024090-3|AAK67220.3| 370|Caenorhabditis elegans Hypothetical protein C52E2.6 protein. Length = 370 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 418 IDPSPKSKLNLESPKKSVTLKYMMIIIIINLYGSC 522 I P+ LN+ES V L ++M II+ + G C Sbjct: 74 ISPTSGKLLNIESGNVRVVLDHLMAIIVWSANGCC 108 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,730,393 Number of Sequences: 27780 Number of extensions: 204032 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1184216096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -