BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0422 (553 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 2.2 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 5.0 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 24.6 bits (51), Expect = 2.2 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = -3 Query: 425 LTYMYYIWFSLN*SLHALARITMK----YIYISFFTTVILLYKGI-DIIRH 288 LT ++W L+ + L + Y + FFTT+I Y + +II H Sbjct: 281 LTEYRHLWVDLSHMMQQLGKAYSNMYGIYCLVIFFTTIIATYGSLSEIIEH 331 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 278 NSFFFHKVGNTRESKIFSNQILVTLVRKLQTVA 180 + F K G R + + +L+ VRK QT+A Sbjct: 507 DGFAMLKKGTNRVTGPLDSDVLIEYVRKRQTIA 539 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,852 Number of Sequences: 2352 Number of extensions: 9083 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -