BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0421 (453 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 27 0.095 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 2.7 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 8.3 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 27.1 bits (57), Expect = 0.095 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 26 LPHIIEKK*SNSTINLCNLVKTNYCNDVIL*RII 127 +PH +++K IN C+L+K ND L R+I Sbjct: 117 VPHELKEKHLTQRINSCDLLKKRNENDPFLKRLI 150 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 367 LANKILKSASQSARPKNIIVTHSTHH 290 L NK+ K A + R ++ THS H Sbjct: 624 LRNKVYKLAMERERDASLSSTHSHPH 649 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 20.6 bits (41), Expect = 8.3 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 359 QNIEISESISAP*KYHSYTFHAPRNEIKYKKFS 261 + +EIS+ SY PRN + +K S Sbjct: 189 KQVEISQMTEPSSSTKSYVLEGPRNGKRKRKSS 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,871 Number of Sequences: 438 Number of extensions: 2234 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -