BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0419 (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) 29 2.9 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 261 LARSLSYTLCRSMCVRSIPASNLMLVHCSICLVSLLNQSSK*CFSSI-YYA***SIMFFF 437 L+ SL Y ++C+ ++ S L C++C+++L S C +I +A S+ + + Sbjct: 1807 LSVSLHYLYPCTICIFALSVSLHYLSLCAVCILALFVSLSYLCLCAICIFALSVSLRYLY 1866 Query: 438 VCLLYKLQLSV 470 +C + LSV Sbjct: 1867 LCAICIFALSV 1877 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +3 Query: 261 LARSLSYTLCRSMCVRSIPASNLMLVHCSICLVSLLNQSSK*CFSSI-YYA***SIMFFF 437 L+ S +Y ++C+ ++ S L C+IC+ +L C +I +A S+ + + Sbjct: 1686 LSVSWNYLYLGTICIFALSVSLRYLYFCTICVFALSVSLRYLCLCAICVFALSVSLRYLY 1745 Query: 438 VCLLYKLQLSV 470 +C + LSV Sbjct: 1746 LCAICIFALSV 1756 >SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) Length = 519 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/43 (25%), Positives = 27/43 (62%) Frame = -1 Query: 585 EDFSLSTSQCEGKRYDHIIYSCFTKKQIFVYFSQLRPIKHLIV 457 + +S + + G +I++SC +++ F+ FS+ +PI+++ V Sbjct: 29 DGYSRAKKRFSGSYKHNILHSCQKREKYFLLFSEKKPIRYVRV 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,037,849 Number of Sequences: 59808 Number of extensions: 397967 Number of successful extensions: 971 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -