BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0416 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 30 1.4 SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) 29 3.3 SB_12157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_44887| Best HMM Match : EGF (HMM E-Value=4.1e-09) 28 5.7 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 28 5.7 SB_22018| Best HMM Match : VKOR (HMM E-Value=5.9) 27 7.6 SB_6697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_46460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 28 CATAAHCSRAATCTRRRYFWRANCAYCSRAAGCARSPASDVHTVRTARV 174 C ++ HC R + RRR R C R+ C RS A + R V Sbjct: 36 CPSSNHCRRCRSIARRRSVARRRSIACHRSVACCRSVARRLFIARRRSV 84 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 28 CATAAHCSRAATCTRRRYFWRANC-AYCSRAAGCARS 135 C AA C R TCT + W +C A C+R + S Sbjct: 377 CTRAAKCDRELTCTCNKK-WEGSCNAICTRTSNATSS 412 >SB_30460| Best HMM Match : DSPc (HMM E-Value=2.5e-38) Length = 550 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -3 Query: 389 SSRPQIERHRPLRHCQSYGTVKSAAREHHVQCAHKQHVRYARQK 258 S RP+I R P+RH SY + ++ H+ K +++ K Sbjct: 88 SWRPKISREIPIRHLSSYYSSQTTTAACHLTSPRKNMLKFLTLK 131 >SB_12157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/39 (28%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 19 KNDCATAAHCSRAATCT-RRRYFWRANCAYCSRAAGCAR 132 KN +A + + C + YFW YC+ C R Sbjct: 107 KNQVISACNATHDTVCRCQEGYFWDTGTLYCAECKSCGR 145 >SB_44887| Best HMM Match : EGF (HMM E-Value=4.1e-09) Length = 193 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 46 CSRAATCTRRRYFWRANCAYCSRAAGCARSPASD 147 C TCT+R + +CA A C ++ +SD Sbjct: 60 CQHGGTCTKRFNGYECSCAPTYTGANCEKALSSD 93 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 46 CSRAATCTRRRYFWRANCAYCSRAAGCARSPASD 147 C TCT+R + +CA A C ++ +SD Sbjct: 1158 CQHGGTCTKRFNGYECSCAPTYTGANCEKALSSD 1191 >SB_22018| Best HMM Match : VKOR (HMM E-Value=5.9) Length = 433 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +3 Query: 192 SLTSGVQTARTARVL--LPARAHLFLACIPHVLLMCTLHVMLASRRL 326 SLT AR AR++ + LFL H + C LH+ S R+ Sbjct: 284 SLTGVTMVARVARLMCIFMTGSDLFLHTTVHRYMSCLLHIYTQSHRI 330 >SB_6697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 595 Score = 27.5 bits (58), Expect = 7.6 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 10 HEVKNDCATAAHCSRAATCTRRRYFWRANC--AYCSRAAGCARSP 138 H +++ A A + ++T +R + R + A S AAGCARSP Sbjct: 475 HSSRDEFADIAEGAGSSTAVSQRAYSRCHIMIAEPSAAAGCARSP 519 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,891,020 Number of Sequences: 59808 Number of extensions: 276732 Number of successful extensions: 840 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -