BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0416 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 30 0.018 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 3.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 3.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.2 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 29.9 bits (64), Expect = 0.018 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 371 ERHRPLRHCQ-SYGTVKSAAREHHVQCAHKQHVRYARQK*MSARRQQ 234 + H H Q G +S A++ H+Q AH+QH+ Y +Q+ A QQ Sbjct: 171 QMHTQHPHMQPQQGQHQSQAQQQHLQ-AHEQHMMYQQQQQSQAASQQ 216 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 316 LASITCSVHISSTCG 272 L IT VHI TCG Sbjct: 12 LPGITIGVHILDTCG 26 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 316 LASITCSVHISSTCG 272 L IT VHI TCG Sbjct: 102 LPGITIGVHILDTCG 116 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 4.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -1 Query: 514 IILKMQAEPISSSAGLQTNYSLLVTP 437 I + + P+S++ G+ T Y ++V P Sbjct: 1098 IRISWMSPPLSAANGVITGYKVIVIP 1123 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 229 RAVRAVCTPEVRERTQPAAR 170 R + A C VR R QPA R Sbjct: 403 RILCACCPGRVRRRYQPAFR 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,479 Number of Sequences: 438 Number of extensions: 1877 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -