BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0415 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_15719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 615 SPAAIFRLANDYYVGRIVMSDLVGNFILLIL 523 SP +F L + YY GR LV N+I+L+L Sbjct: 290 SPLFLFYLVDAYYPGRNRKVSLVANYIILVL 320 >SB_39580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 302 KHKSCKIYEHVHTYFTYLKYNWLN 231 K+ +I H+H FT ++ NW N Sbjct: 49 KYSCARILAHLHVLFTRVRRNWTN 72 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,614,861 Number of Sequences: 59808 Number of extensions: 343726 Number of successful extensions: 699 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -