BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0412 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0652 + 4895366-4895483,4895661-4896262 28 4.8 11_05_0098 + 19041790-19041894,19042363-19043274,19043605-19043868 27 8.4 >07_01_0652 + 4895366-4895483,4895661-4896262 Length = 239 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 357 YMNVKYEPNNCGEAFSR*MIRIVKKRDSLLHFDSAFE 247 YM Y +C + R + ++V+KRDS +H SAF+ Sbjct: 134 YMECAYYRKDCRK-LRRFISKVVEKRDSAMHACSAFK 169 >11_05_0098 + 19041790-19041894,19042363-19043274,19043605-19043868 Length = 426 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 337 FVFHVHIYMFPDTSVLVKSICLFIISQNFLKINSSRGIKKTKAMYTNTKLNKI 495 + F +H++ ++ VKS+CL +S N L S G + L+K+ Sbjct: 164 YSFPLHLFSVGGSNSCVKSLCLGFVSLNLLHQLSPAGNTNRLTILKKLTLHKV 216 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,155,536 Number of Sequences: 37544 Number of extensions: 195799 Number of successful extensions: 298 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -