BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0407 (599 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38823.1 68415.m04770 expressed protein 33 0.19 At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein ... 31 0.58 At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR... 31 0.77 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 31 0.77 At3g28770.1 68416.m03591 expressed protein 30 1.0 At5g02940.1 68418.m00237 expressed protein 30 1.3 At3g05110.1 68416.m00555 hypothetical protein 29 1.8 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 29 1.8 At3g50320.1 68416.m05503 hypothetical protein 29 2.4 At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (T... 29 3.1 At5g56920.1 68418.m07106 expressed protein 29 3.1 At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-conta... 29 3.1 At3g53040.1 68416.m05846 late embryogenesis abundant protein, pu... 29 3.1 At2g36740.1 68415.m04507 YL1 nuclear family protein similar to Y... 28 4.1 At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding famil... 28 4.1 At1g56660.1 68414.m06516 expressed protein 28 4.1 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 28 5.4 At3g28510.1 68416.m03561 AAA-type ATPase family protein contains... 28 5.4 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 28 5.4 At1g27580.1 68414.m03361 F-box family protein similar to F-box p... 28 5.4 At1g27540.1 68414.m03357 F-box family protein similar to F-box p... 28 5.4 At5g62390.1 68418.m07830 calmodulin-binding family protein conta... 27 7.2 At4g17970.1 68417.m02675 expressed protein contains Pfam profile... 27 7.2 At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containi... 27 7.2 At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase I... 27 9.5 At4g23800.1 68417.m03422 high mobility group (HMG1/2) family pro... 27 9.5 At4g17585.1 68417.m02629 hypothetical protein 27 9.5 At4g08430.1 68417.m01392 Ulp1 protease family protein similar to... 27 9.5 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 27 9.5 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 27 9.5 At3g05760.1 68416.m00647 expressed protein 27 9.5 >At2g38823.1 68415.m04770 expressed protein Length = 258 Score = 32.7 bits (71), Expect = 0.19 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +1 Query: 76 KTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKL--KKENRLIETIPEDDPEKKKHAVYV 249 K + D RK D+ ++ T H +K +L K +LI + + D E+K+H V Sbjct: 139 KKMPRSDRRKAAHDLLKDVCNPTSHDSLRKSVELEIKALKKLIREL-QKDWEEKQH-VKQ 196 Query: 250 MTMKLFADMERKRQHLGSKR 309 T + D+E+K +HL K+ Sbjct: 197 YTKNKYKDLEQKVKHLEKKK 216 >At3g57150.1 68416.m06363 dyskerin, putative / nucleolar protein NAP57, putative similar to SP|P40615 Dyskerin (Nucleolar protein NAP57) {Rattus norvegicus}; contains Pfam profiles PF01509: TruB family pseudouridylate synthase (N terminal domain), PF01472: PUA domain; supporting cDNA gi|8901185|gb|AF234984.2|AF234984 Length = 565 Score = 31.1 bits (67), Expect = 0.58 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 100 RKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKK 234 +KK D EE +E ++K+KK K+ +IE + EKKK Sbjct: 478 KKKKKDKEEEKEEEAGSEKKEKKKKKDKKEEVIEEVASPKSEKKK 522 >At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1607 Score = 30.7 bits (66), Expect = 0.77 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 387 RILRNLDRVASRAGRPSSPRVKIKRKR 467 +IL+ L RV S RPS PR K+ +KR Sbjct: 658 KILKELPRVCSSITRPSLPRDKLSKKR 684 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 30.7 bits (66), Expect = 0.77 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Frame = +1 Query: 103 KKCLDIYEEAKERTDHMIEQKR----KKLKKENRLIETIPEDD--PEKKKHAVYVMTMKL 264 K+ LDI EE KE E+K+ K +K E TI ED P V T K+ Sbjct: 426 KRTLDISEEIKEHQKETGEEKKEAPVKSVKFEQTRNATIAEDSTIPSTNPDTVLESTEKV 485 Query: 265 FADMERK 285 +D+E++ Sbjct: 486 DSDLEKQ 492 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 30.3 bits (65), Expect = 1.0 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 2/91 (2%) Frame = +1 Query: 64 SRAWKTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAV 243 S+ K D KK + +E KE +H ++K K + E+ ED EKKKH Sbjct: 1048 SKKEKEESRDLKAKKKEEETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEE 1107 Query: 244 YVMTMKL--FADMERKRQHLGSKRHGGKETK 330 K DME+ +K+ K K Sbjct: 1108 SKSRKKEEDKKDMEKLEDQNSNKKKEDKNEK 1138 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/83 (22%), Positives = 37/83 (44%) Frame = +1 Query: 76 KTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYVMT 255 K E+ ++ + YEE K +T E K++K K +++ E ++ + KK Sbjct: 1000 KESEDSASKNREKKEYEEKKSKTKE--EAKKEKKKSQDKKREEKDSEERKSKKEKEESRD 1057 Query: 256 MKLFADMERKRQHLGSKRHGGKE 324 +K E ++ S+ H K+ Sbjct: 1058 LKAKKKEEETKEKKESENHKSKK 1080 >At5g02940.1 68418.m00237 expressed protein Length = 813 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 85 ENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKK 183 E DDTRK+ +YEE K R + +I + K L K Sbjct: 512 ETDDTRKQ---VYEEKKSRLEKIITRPSKSLSK 541 >At3g05110.1 68416.m00555 hypothetical protein Length = 372 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +1 Query: 91 DDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYVMTMKLFA 270 D +R++ D+ + KE + I + ++++KE LIET + ++ V + F Sbjct: 27 DQSRERVSDLEQIQKEDSSEEICTESERMRKETELIETSLKQLEARENELREVEAKRKFF 86 Query: 271 DMERK 285 D++ K Sbjct: 87 DLKEK 91 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +1 Query: 124 EEAKERTDHMIEQ-KRKKLKKENRLIETIPEDDPEKKKHAVYVMTMKLFADMERKRQHLG 300 EE KE D +++ K+KK K E E+D +KK M+ + E+ + Sbjct: 435 EEGKEPVDASVKKSKKKKAKGEEEEEVVAMEEDKSEKKKKKEKRKMETAEENEKSEKKKT 494 Query: 301 SKRHGGKETKT 333 K G E +T Sbjct: 495 KKSKAGGEEET 505 >At3g50320.1 68416.m05503 hypothetical protein Length = 144 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +3 Query: 372 RKNGQRILRNLDRVASRAGRPSSPRVKIKRKRKYNRSNLLNRNQRADNYSNR 527 R G+ +L NL R G S RV R NRS++ NRN+ N+ R Sbjct: 53 RDKGEHLLNNLGRDNDEGGL--SLRVGGMGGRDVNRSSVKNRNKLQTNHDQR 102 >At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (TITAN3) very strong similarity to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1175 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +1 Query: 118 IYEEAKERTDHMIEQKRKKLKKENRLI--ETIPEDDPEKKKHAVYVMTMKLFADMERKRQ 291 +YE KE +E+K+ K+ + N+L+ E +P + +K+ + Y+ A+++R R+ Sbjct: 173 MYENKKEAALKTLEKKQTKVDEINKLLDHEILPALEKLRKEKSQYMQWANGNAELDRLRR 232 >At5g56920.1 68418.m07106 expressed protein Length = 227 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/78 (23%), Positives = 38/78 (48%) Frame = +1 Query: 73 WKTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYVM 252 W T E+D+ ++ L + + ++ I+ ++ +R ++ P + E+K +AV + Sbjct: 38 WGTAEDDEYLRQYLLFHYQFQKTQGFSIKWEQFDYNFRSRSMDKSPNEISERKSNAVLIR 97 Query: 253 TMKLFADMERKRQHLGSK 306 M L A + H G+K Sbjct: 98 EMTLTAIDKHNEAH-GTK 114 >At5g49580.1 68418.m06136 DNAJ heat shock N-terminal domain-containing protein contains similarity to S-locus protein 5 GI:6069485 from [Brassica rapa]; contains Pfam profile PF00226 DnaJ domain Length = 695 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 3 VHPDKNMDDSERAQQAFEIVKSSLE 77 VHPDKNM +ERA +AF+ ++++ E Sbjct: 437 VHPDKNM-GNERAAEAFKKLQNAYE 460 >At3g53040.1 68416.m05846 late embryogenesis abundant protein, putative / LEA protein, putative similar to LEA protein in group 3 [Arabidopsis thaliana] GI:1526424; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 479 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/49 (28%), Positives = 30/49 (61%) Frame = +1 Query: 85 ENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKK 231 + ++T++K ++ + AKE+ D E+ R+K+ +E RL ++D +K Sbjct: 313 KTEETKQKAVETKDTAKEKMDEAGEEARRKM-EEMRLEGKKLDEDASRK 360 >At2g36740.1 68415.m04507 YL1 nuclear family protein similar to YL-1 protein (Transcription factor-like 1) (Swiss-Prot:Q15906) [Homo sapiens] Length = 379 Score = 28.3 bits (60), Expect = 4.1 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 3/82 (3%) Frame = +1 Query: 88 NDDTRKKCLDI-YEEAKERTDHMIEQKRKKLKK--ENRLIETIPEDDPEKKKHAVYVMTM 258 NDD CL I Y KE + K+L+ + RLI +KKK V + Sbjct: 68 NDDVFMSCLCIEYLFIKEPEPDAVAVNEKELRDLPKKRLIYPGKTASKKKKKKTKVVSQL 127 Query: 259 KLFADMERKRQHLGSKRHGGKE 324 + E+ + LG+K KE Sbjct: 128 EYIPGDEKPGEELGNKEQEEKE 149 >At2g13370.1 68415.m01476 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to SP|O14647 Chromodomain-helicase-DNA-binding protein 2 (CHD-2) {Homo sapiens}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 1722 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = +1 Query: 85 ENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKH 237 E D K Y+EA D+ + +KL EN E+D E KH Sbjct: 112 EGSDPAKDSQSGYKEAYHSEDNHSNDRSEKLDSENENDNENEEEDNEMNKH 162 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 28.3 bits (60), Expect = 4.1 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = +1 Query: 85 ENDDTRKKCLDIYEEAKERTDHMIEQK-RKKLKKENRLIETIPEDDPEKKKHAVYVMTMK 261 E DDT +K E + ++K +KK KK++ + ED+ EKK + V Sbjct: 407 EEDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEG 466 Query: 262 LFADMERKRQHLGSKRHG 315 A E+K + + K+ G Sbjct: 467 SKAKEEKKDKDVKKKKGG 484 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 136 ERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKH 237 + T H K KK KK+ E P+ P K+KH Sbjct: 402 DSTPHESNGKTKKKKKKKTHKEEQPQTSPRKRKH 435 >At3g28510.1 68416.m03561 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 530 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 103 KKCLDIYEEAKERTDHMI-EQKRKKLKKENRLIETIPEDDPEKKK 234 K+ + EE KE+ + E+++KK +KE + ++ E + +KKK Sbjct: 451 KRLVKTLEEEKEKARKLAEEEEKKKAEKEAKKMKKAEEAEEKKKK 495 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +1 Query: 73 WKTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIET 204 WK +E+ RK C+ + ++ D+++ +K + E R +E+ Sbjct: 64 WKWIEDYCWRKGCMRSQNQCNDKWDNLMRDYKKVREYERRRVES 107 >At1g27580.1 68414.m03361 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana]; confirmed by FLcDNA GI:16604421; contains uncharacterized Arabidoppsis domain shared by 33 Arabidopsis proteins;simlar to unknown protein GB:AAC63676 Length = 364 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 225 LWIIFRNGFY*AVFLFQLFPFL 160 LW+ +NG Y V+ F+++PFL Sbjct: 125 LWVDDKNGNYVVVWQFEMYPFL 146 >At1g27540.1 68414.m03357 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana]; confirmed by FLcDNA GI:16604421; contains uncharacterized Arabidoppsis domain shared by 33 Arabidopsis proteins Length = 413 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 225 LWIIFRNGFY*AVFLFQLFPFL 160 LW+ +NG Y V+ F+++PFL Sbjct: 174 LWVDDKNGNYVVVWQFEMYPFL 195 >At5g62390.1 68418.m07830 calmodulin-binding family protein contains IQ calmodulin-binding motif, Pfam:PF00612 Length = 446 Score = 27.5 bits (58), Expect = 7.2 Identities = 29/112 (25%), Positives = 53/112 (47%) Frame = +1 Query: 127 EAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYVMTMKLFADMERKRQHLGSK 306 E KE+ + + + +KK K +IE E+D E +H V+ K F+ R+ + +K Sbjct: 239 EEKEKKEKIETKSKKKEKTRVVVIEEEEEEDDESSEHGAIVL-RKAFS---RRNGAVRTK 294 Query: 307 RHGGKETKT*G*N*TGDSSVLRERMGKEF*GISTESRRELEDLPVHE*R*KE 462 + KE ++V+ +R K + ++S R L DL + + + KE Sbjct: 295 KGKNKEMP------PEYAAVMIQRAFKAYLIRRSKSLRALRDLAIAKTKLKE 340 >At4g17970.1 68417.m02675 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 560 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 124 EEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYV 249 EE +T M+ + +K+KK + + + ++DP + HA+ V Sbjct: 13 EEGLSKTKWMVLEPSEKIKKIPKRLWNVGKEDPRRVIHALKV 54 >At3g18020.1 68416.m02290 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 688 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 83 NVFQARLHYFKSLLSTLRVIHILI 12 NV ARL Y +S +STL VIH LI Sbjct: 129 NVIIARLLYSRSPVSTLGVIHRLI 152 >At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase IV GI:9651815 from [Arabidopsis thaliana]; identical to cDNA DNA ligase IV, GI:9651814 Length = 1219 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/82 (20%), Positives = 39/82 (47%) Frame = +1 Query: 70 AWKTLENDDTRKKCLDIYEEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYV 249 A +++EN++TR+ + Y E+++R D+ + + N E ++ + + + Sbjct: 1080 AGRSVENEETREPDIAKYTESQQR-DNTVAVEEALQDSRNAKTEMDMKEKLQIHEDPLQA 1138 Query: 250 MTMKLFADMERKRQHLGSKRHG 315 M MK+F +K ++ G Sbjct: 1139 MLMKMFPIPSQKTTETSNRTTG 1160 >At4g23800.1 68417.m03422 high mobility group (HMG1/2) family protein similar to HMG2B [Homo sapiens] GI:32335; contains Pfam profile PF00505: HMG (high mobility group) box Length = 456 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +1 Query: 133 KERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYVMTMKLFADMERKR 288 KE+TD++I++++ KK+N E + + P+K + + LF+ ERK+ Sbjct: 353 KEKTDNLIKKEKATKKKKN---ENVDPNKPKKPASSYF-----LFSKDERKK 396 >At4g17585.1 68417.m02629 hypothetical protein Length = 152 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 124 EEAKERTDHMIEQKRKKLKKENRLIETIPEDDPEKKKHAVYV 249 EE +T M+ + +K+KK + + ++ ++DP + HA V Sbjct: 13 EEGLSKTKWMVLEPSEKIKKIPKRLWSVGKEDPRRVIHAFKV 54 >At4g08430.1 68417.m01392 Ulp1 protease family protein similar to At5g45570, At5g28235; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 808 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 154 IEQKRKKLKKENRLIETIPEDDPEKKKHAVYVMTMKLFAD 273 +E+ + ++KK +E + PEKKK +V T K F D Sbjct: 390 VEKPKPEMKKTAVKVEKVDSPKPEKKK-SVVAPTTKTFDD 428 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 405 DRVASRAGRPSSPRVKIKRKRKYNRSNLLNRNQRADNYS 521 DR A + S +IKRKR+Y+ S+ + + +D+ S Sbjct: 205 DREAKETRKKESNEKRIKRKRRYSSSDSYSSSSDSDSDS 243 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 405 DRVASRAGRPSSPRVKIKRKRKYNRSNLLNRNQRADNYS 521 DR A + S +IKRKR+Y+ S+ + + +D+ S Sbjct: 205 DREAKETRKKESNEKRIKRKRRYSSSDSYSSSSDSDSDS 243 >At3g05760.1 68416.m00647 expressed protein Length = 202 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 133 KERTDHMIEQKR--KKLKKENRLIETIPEDDPE 225 +E + + Q+R KK KK+ +++E PE DPE Sbjct: 154 QEEEEELKRQRREKKKEKKKGKVVEEEPEMDPE 186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,647,725 Number of Sequences: 28952 Number of extensions: 231511 Number of successful extensions: 994 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 984 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -