BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0405 (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1362 - 26006159-26006461,26006691-26006841,26006975-260072... 29 3.0 >07_03_1362 - 26006159-26006461,26006691-26006841,26006975-26007212, 26007293-26007503,26007631-26007755,26007895-26008023, 26008540-26009326 Length = 647 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 350 RATYTIQLFVLAIAQSTSQTINNQINKYAMMSCRCENLIRWMW 222 R Y+ +L V + + + + N YA++S CE+L +W Sbjct: 507 RGQYSTKLDVFSFGVLVLEIVTGRRNSYAVVSEHCEDLFSLVW 549 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,273,767 Number of Sequences: 37544 Number of extensions: 208403 Number of successful extensions: 322 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -