BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= P5PG0402
(567 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
01_02_0093 - 11063514-11064755,11065364-11065483,11066459-11066785 31 0.85
>01_02_0093 - 11063514-11064755,11065364-11065483,11066459-11066785
Length = 562
Score = 30.7 bits (66), Expect = 0.85
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = +3
Query: 357 FKSADCFLFAEHVKPEDDTWTAFDYLKDVTKLTFTKNNITMKYIPTEALKY 509
F S C LF EH + D +A ++++++TKL K+ + + I LKY
Sbjct: 441 FDSKTCELFLEHYMGKGDMTSALNWVENMTKLPRKKSKLDQEKISC-FLKY 490
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,206,185
Number of Sequences: 37544
Number of extensions: 270489
Number of successful extensions: 554
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 544
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 554
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1305140760
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -