SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0402
         (567 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   4.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   4.9  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    21   8.6  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   8.6  

>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 6/11 (54%), Positives = 11/11 (100%)
 Frame = -1

Query: 507  ISTPQSVYISW 475
            +S+PQ+++ISW
Sbjct: 1224 VSSPQALFISW 1234


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 6/11 (54%), Positives = 11/11 (100%)
 Frame = -1

Query: 507  ISTPQSVYISW 475
            +S+PQ+++ISW
Sbjct: 1220 VSSPQALFISW 1230


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -3

Query: 493 VGIYFMVILFFVKVSLVTSL 434
           +G YF  I+F V  S+V+++
Sbjct: 294 LGTYFNCIMFMVASSVVSTI 313


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = -3

Query: 166 NDSSNFLFKNNSLESHYNIIALFKFRTTTP 77
           N++ N  + NN  + +YNII + +     P
Sbjct: 340 NNNYNNNYNNNCKKLYYNIINIEQIPVPVP 369


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,949
Number of Sequences: 438
Number of extensions: 3452
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16440594
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -