BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0401 (621 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosa... 28 1.3 SPBC1271.04c |||deoxyhypusine synthase|Schizosaccharomyces pombe... 27 1.7 SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 26 5.1 SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces... 25 6.7 SPBC409.08 |||spermine family transporter |Schizosaccharomyces p... 25 8.8 SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch... 25 8.8 >SPAC11E3.08c |nse6||Smc5-6 complex non-SMC subunit Nse6|Schizosaccharomyces pombe|chr 1|||Manual Length = 522 Score = 27.9 bits (59), Expect = 1.3 Identities = 14/65 (21%), Positives = 32/65 (49%) Frame = -2 Query: 320 DILYKIIHSLLDSPELLSQISLNIKFSARRVNQNNLFALLIYKNNISYYNPITRMCRTYN 141 D L IH + +SP + I ++ S ++ + F L + K + + + + +C+ + Sbjct: 325 DFLISNIHKVSESPRVWVTILSSLSRSCQKFRKKIAFTLFVGKQSKNDDSDFSSLCQRLD 384 Query: 140 ELARS 126 E++ S Sbjct: 385 EISAS 389 >SPBC1271.04c |||deoxyhypusine synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 27.5 bits (58), Expect = 1.7 Identities = 17/79 (21%), Positives = 37/79 (46%), Gaps = 4/79 (5%) Frame = -2 Query: 392 RQIRAKTI-KL*HAVTRRSTYMH*SDILYKIIHSLLDSPELLSQI---SLNIKFSARRVN 225 + +RAK + ++ + + Y + ++ I++ +++ E L S I+ + +N Sbjct: 147 KNLRAKGLNRIGNLIVPNDNYCRFEEWIFPILNKMVEEQETLGTHWTPSSFIRRLGKEIN 206 Query: 224 QNNLFALLIYKNNISYYNP 168 + YKNNI Y+P Sbjct: 207 DESSVLYWAYKNNIPIYSP 225 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -2 Query: 212 FALLIYKNNISYYNPITRMCRTYNELARSSPELDIFTC 99 F L ++ + +S T+ RT+ ELA +S +++ +C Sbjct: 3771 FVLNLFDSLLSSIETATKNMRTFKELAETSSFIEMSSC 3808 >SPBC660.07 |ntp1||alpha,alpha-trehalase Ntp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 735 Score = 25.4 bits (53), Expect = 6.7 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -2 Query: 185 ISYYNPITRMCRTYNELARSSPELDIFTCRLVTFRKMFKGILHFINR 45 I+YY I RTY L P L R+ K +G L F++R Sbjct: 319 ITYYGKILNANRTYYLLRSQPPFLTDMALRVYERIKNEEGSLDFLHR 365 >SPBC409.08 |||spermine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 25.0 bits (52), Expect = 8.8 Identities = 8/24 (33%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 187 IYLTIIPLPECVVPI-TNWQGRHL 119 +YLT++P+PE P+ W+ + + Sbjct: 270 MYLTLLPVPETYAPVLLRWRAQRI 293 >SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 25.0 bits (52), Expect = 8.8 Identities = 15/76 (19%), Positives = 31/76 (40%) Frame = -2 Query: 284 SPELLSQISLNIKFSARRVNQNNLFALLIYKNNISYYNPITRMCRTYNELARSSPELDIF 105 SPE + + +++ + +N F L + ++ + T NEL SPE + Sbjct: 70 SPEYVENLESRVRYLETLLKKNTNFDLSSNSPSFLFFLREQKFQAT-NELENMSPERKVI 128 Query: 104 TCRLVTFRKMFKGILH 57 ++ + +F H Sbjct: 129 FTSMINYGNLFVDAKH 144 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,374,871 Number of Sequences: 5004 Number of extensions: 46277 Number of successful extensions: 110 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -