BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0401 (621 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016670-4|AAB66105.2| 232|Caenorhabditis elegans Hypothetical ... 30 1.2 AF016670-3|AAB66106.1| 232|Caenorhabditis elegans Hypothetical ... 30 1.2 >AF016670-4|AAB66105.2| 232|Caenorhabditis elegans Hypothetical protein K02F6.5 protein. Length = 232 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -3 Query: 445 LS*F*VNS*LLLHVFRNCGKYEQRLLNYNMQSLEDRRTCTDLIYYIR 305 LS + VN+ L H+ R CG ++L N+N+ SL T D + Y++ Sbjct: 117 LSDYQVNNNDLQHMVRICGDILRKLGNHNILSLPSVYTFDDYVNYLK 163 >AF016670-3|AAB66106.1| 232|Caenorhabditis elegans Hypothetical protein K02F6.8 protein. Length = 232 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -3 Query: 445 LS*F*VNS*LLLHVFRNCGKYEQRLLNYNMQSLEDRRTCTDLIYYIR 305 LS + VN+ L H+ R CG ++L N+N+ SL T D + Y++ Sbjct: 117 LSDYQVNNNDLQHMVRICGDILRKLGNHNILSLPSVYTFDDYVNYLK 163 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,053,061 Number of Sequences: 27780 Number of extensions: 253871 Number of successful extensions: 563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -