BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0401 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 3.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 4.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 7.3 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 219 QFVCIANLQKQYILL*SHYPNVSYL*RTGKVVT*VRYFY 103 +FVCIA + + + +P+V+YL G + R FY Sbjct: 192 EFVCIATPEAIELHFTTDHPSVAYL-LVGSLKGIARQFY 229 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 394 CGKYEQRLLNYNMQS 350 CG++E+RLLN + S Sbjct: 51 CGRHEKRLLNELLSS 65 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 394 CGKYEQRLLNYNMQS 350 CG++E+RLLN + S Sbjct: 51 CGRHEKRLLNELLSS 65 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 281 PELLSQISLNIKFSARRVNQNNLFALLIYKNN 186 P+++S +S N K+S NN Y NN Sbjct: 312 PKIISSLSNNYKYSNYNNYNNNYNNYNNYNNN 343 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 230 VNQNNLFALLIYKNNISYYNPIT 162 + N FAL+IY N+ + + +T Sbjct: 203 IGDNEGFALIIYNNSDNSFQRLT 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,883 Number of Sequences: 438 Number of extensions: 3220 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -