BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0399 (395 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 26 0.18 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 5.1 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 25.8 bits (54), Expect = 0.18 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 192 PCRSASTLLTEPSILMNMQRKCHRGRRAELYPKPLQ 299 PC +T LTEP L N R+ + A LYP +Q Sbjct: 194 PCNVLATSLTEPYTLRNYGRRINCTYVA-LYPSSVQ 228 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.0 bits (42), Expect = 5.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 1 LLFLNHFYTLECYIHNGIETSDHVEKRFQDSINSTIGGSR 120 L F+N + IH+ + +D VE R + +S IG SR Sbjct: 405 LWFINKIIPIRMSIHDELLGADLVEHRIR---HSQIGISR 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,626 Number of Sequences: 438 Number of extensions: 2174 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -