BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0397 (490 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.43 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 23 2.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 3.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 3.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 3.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.3 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.43 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 194 YNDPRFRTVEAGPTLGHYWKNG 259 YN RFR + G + ++W NG Sbjct: 388 YNMVRFRNLVKGTKIDNWWDNG 409 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/38 (21%), Positives = 17/38 (44%) Frame = +2 Query: 281 DYVEEVYDASQYHGQDGLGAYAYGYQTPESAKVENRVR 394 DY E +Y+G + + Y Y+ + + N ++ Sbjct: 247 DYGNEAISKREYNGIGAVIEFKYSYEISNAFRGNNNLK 284 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 362 EFGIRRHMHLDRLVRGIG 309 ++ + RH H+ RLV IG Sbjct: 104 KYWVERHKHIVRLVTAIG 121 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 283 VLSILDFLSVLPVVSKSGACF 221 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 283 VLSILDFLSVLPVVSKSGACF 221 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 283 VLSILDFLSVLPVVSKSGACF 221 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.0 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 341 MHLDRLVRGIGTHRILLQRSPQYSRFPFRSSSSV 240 MH D L T L + Q ++ P SSS+V Sbjct: 505 MHKDSLGLSTATSTCSLAVAKQQNQVPLTSSSNV 538 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 9.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 385 SRQIRRRHRLVYLQGRQ 435 SR + R++YL+GR+ Sbjct: 722 SRYAEKSRRMLYLRGRE 738 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 311 QYHGQDGLGAYAYG 352 QY QDG G YG Sbjct: 920 QYKTQDGFGPIHYG 933 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,341 Number of Sequences: 438 Number of extensions: 2959 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -