BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0397 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62780.1 68418.m07881 DNAJ heat shock N-terminal domain-conta... 29 2.2 At5g11920.1 68418.m01394 glycosyl hydrolase family 32 protein si... 28 3.9 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 28 3.9 At1g19220.1 68414.m02392 transcriptional factor B3 family protei... 28 3.9 At5g45190.1 68418.m05547 cyclin family protein similar to cyclin... 27 5.1 At5g15730.1 68418.m01840 serine/threonine protein kinase, putati... 27 5.1 At2g18790.1 68415.m02187 phytochrome B (PHYB) Identical to SP|P1... 27 6.8 At1g13710.1 68414.m01611 cytochrome P450 family protein similar ... 27 6.8 At5g61020.2 68418.m07656 YT521-B-like family protein contains Pf... 27 9.0 At5g61020.1 68418.m07655 YT521-B-like family protein contains Pf... 27 9.0 At2g15670.1 68415.m01794 hypothetical protein 27 9.0 >At5g62780.1 68418.m07881 DNAJ heat shock N-terminal domain-containing protein contains Pfam PF00226: DnaJ domain; similar to dnaJ (GI:144832) [Clostridium acetobutylicum] Length = 207 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 243 CPRVGPASTVRNLGSLYLINGKTAVR 166 CP G S + N+ S +ING+T +R Sbjct: 104 CPNCGQNSAMTNISSTEVINGRTFIR 129 >At5g11920.1 68418.m01394 glycosyl hydrolase family 32 protein similar to fructan 1-exohydrolase IIa GI:13940209 from [Cichorium intybus]; contains Pfam profile PF00251: Glycosyl hydrolases family 32 Length = 550 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +2 Query: 338 AYAYGYQTPESAKVENRVRSGDVTGSYIYKDGKNDLI--KVRYWSDRD 475 +Y G +T +++V ++ G+ Y++ DG+N +I + WS R+ Sbjct: 494 SYGVGGKTVITSRVYPKLAIGEAAKLYVFNDGENGVIMTSLEAWSMRN 541 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 379 RKSRQIRRRHRLVYLQGRQKRSHQ 450 R S + + RHRL+ +G QK +HQ Sbjct: 201 RLSAENKTRHRLIQQKGHQKENHQ 224 >At1g19220.1 68414.m02392 transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related contains Pfam profile: PF02309 AUX/IAA family Length = 1086 Score = 27.9 bits (59), Expect = 3.9 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +2 Query: 83 DVFQIDIEPEEAQKYLNSPPFT---DPQLAGRTAVLPLIKYNDPRFRTVEAG 229 D I I A NS PFT +P+ + V+PL KYN + V G Sbjct: 242 DSMHIGILAAAAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLG 293 >At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1 [Equus caballus] GI:5052355; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 579 Score = 27.5 bits (58), Expect = 5.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 67 RRRHNSDPGENRHNTQHVSS 8 +RRHNS+ GE H T SS Sbjct: 543 KRRHNSENGEESHKTSRGSS 562 >At5g15730.1 68418.m01840 serine/threonine protein kinase, putative similar to protein-serine/threonine kinase [Nicotiana tabacum] gi|505146|dbj|BAA06538 Length = 434 Score = 27.5 bits (58), Expect = 5.1 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -3 Query: 374 SQIREFGIRRHMHLDRLVRGI-GTHRILLQRSPQY-SRFPFRSSSSVQEWGLLQL 216 +++ +FG+ + M LDR+ G+ GTH + P Y S + S + +G++ L Sbjct: 251 AKVADFGLSKEMVLDRMTSGLKGTHGYM---DPTYISTNKYTMKSDIYSFGVIIL 302 >At2g18790.1 68415.m02187 phytochrome B (PHYB) Identical to SP|P14713 Phytochrome B {Arabidopsis thaliana} Length = 1172 Score = 27.1 bits (57), Expect = 6.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 248 SSVQEWGLLQLCETSGRCI*SMVRQRCGQLIE 153 SS++ WGL+ TS RCI +R C L++ Sbjct: 392 SSMRLWGLVVCHHTSSRCIPFPLRYACEFLMQ 423 >At1g13710.1 68414.m01611 cytochrome P450 family protein similar to cytochrome P450 78A1 (SP:P48420) GI:349717 from [Zea mays] Length = 517 Score = 27.1 bits (57), Expect = 6.8 Identities = 20/67 (29%), Positives = 32/67 (47%) Frame = +2 Query: 77 GIDVFQIDIEPEEAQKYLNSPPFTDPQLAGRTAVLPLIKYNDPRFRTVEAGPTLGHYWKN 256 G F I EPE A++ L+S F D + + + L+ + R + P G YW+N Sbjct: 91 GFSRFVISSEPETAKEILSSSAFADRPV--KESAYELLFH-----RAMGFAP-YGEYWRN 142 Query: 257 GKEIENT 277 + I +T Sbjct: 143 LRRISST 149 >At5g61020.2 68418.m07656 YT521-B-like family protein contains Pfam profile PF04146: YT521-B-like family Length = 493 Score = 26.6 bits (56), Expect = 9.0 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +2 Query: 299 YDASQYH--GQDGLGAYAYGYQTP 364 Y ++ Y+ G G GAYAYGY P Sbjct: 77 YQSAAYNAKGSYGKGAYAYGYYPP 100 >At5g61020.1 68418.m07655 YT521-B-like family protein contains Pfam profile PF04146: YT521-B-like family Length = 495 Score = 26.6 bits (56), Expect = 9.0 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +2 Query: 299 YDASQYH--GQDGLGAYAYGYQTP 364 Y ++ Y+ G G GAYAYGY P Sbjct: 79 YQSAAYNAKGSYGKGAYAYGYYPP 102 >At2g15670.1 68415.m01794 hypothetical protein Length = 193 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +3 Query: 195 TTTRGFAQLKQAPLLDTTGRTERKSRILRT 284 T+ R +++ + +++ G TER +R+L+T Sbjct: 45 TSKRKYSKFQDISVIEQVGNTERHARVLKT 74 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,092,534 Number of Sequences: 28952 Number of extensions: 237935 Number of successful extensions: 760 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -