BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0395 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 74 3e-15 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 3.0 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 24 4.0 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 24 4.0 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 5.3 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 9.3 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 74.1 bits (174), Expect = 3e-15 Identities = 41/117 (35%), Positives = 63/117 (53%), Gaps = 1/117 (0%) Frame = +1 Query: 211 SDISTVIEGSMKIHAQYHYTMETQTSVATPTE-DGLEIYSSTQWLDLTNIAIAKCLDMPV 387 S+ +IEG ++ Q H+ +ETQ A P + D +E+ SSTQ +A+ L +P Sbjct: 716 SEADVIIEGDCRMGGQEHFYLETQACSAVPKDSDEIEVISSTQHPTEIQHHVAQTLGIPA 775 Query: 388 NSINIIVRRLGGGYGSKITRASQIACAAALVTRFLGRTCRFILPLQTNMKAIGKRIP 558 + + V+RLGGG+G K +RA+ +A AL +GR R +L +M G R P Sbjct: 776 SKVVSRVKRLGGGFGGKESRAAIVAIPVALAAHRMGRPVRCMLDRDEDMAVSGTRHP 832 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.2 bits (50), Expect = 3.0 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 208 GSDISTVIEGSMKIHAQYHYTMETQTSVATPTEDGL-EIYSSTQWLD 345 GSD+++++ S + Q TMET T++ G ++ S LD Sbjct: 950 GSDLTSLLPNSFEALDQSLLTMETTTTIIRDRVSGYSSLHESQNRLD 996 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.8 bits (49), Expect = 4.0 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +1 Query: 4 DPPGCRNSARGIIVADREKTATKLLDLSKSKYDFVNKEKPLLTIDEVLNSPKRKTL 171 D P SAR ++ + K + L+ +YD V ++ + E+LN +R+ + Sbjct: 56 DAPKVGRSARLMVTREDHKRVEEFLEQHDIEYDLVAED-----VQELLNREQRRNV 106 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.8 bits (49), Expect = 4.0 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +1 Query: 4 DPPGCRNSARGIIVADREKTATKLLDLSKSKYDFVNKEKPLLTIDEVLNSPKRKTL 171 D P SAR ++ + K + L+ +YD V ++ + E+LN +R+ + Sbjct: 56 DAPKVGRSARLMVTREDHKRVEEFLEQHDIEYDLVAED-----VQELLNREQRRNV 106 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 422 PPNRRTMMLILLTGISKHF 366 PP+R TM LI GIS F Sbjct: 65 PPDRDTMCLIRCIGISLDF 83 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 22.6 bits (46), Expect = 9.3 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +1 Query: 217 ISTVIEGSMKIHAQYHYTMETQTSVATPTEDGLEIYSSTQWLDLTNIAIAKCL 375 + T +E ++ +++ ++TQ S T + E+ + WL +TNI + L Sbjct: 1694 LDTHVEKLDRLFKEFN-VLDTQASELVQTAEMDELSVNIIWLFVTNILLGALL 1745 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,079 Number of Sequences: 2352 Number of extensions: 12027 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -