BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0391 (588 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC042145-1|AAH42145.1| 837|Homo sapiens zinc fingers and homeob... 29 9.2 AB083653-1|BAC76615.1| 837|Homo sapiens transcription factor ZH... 29 9.2 AB020661-1|BAA74877.2| 868|Homo sapiens KIAA0854 protein protein. 29 9.2 >BC042145-1|AAH42145.1| 837|Homo sapiens zinc fingers and homeoboxes 2 protein. Length = 837 Score = 29.5 bits (63), Expect = 9.2 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = -1 Query: 405 VSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRS 226 VS + IT T+ PL T I + P PP +V+N + ++++ Sbjct: 388 VSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTPASDRKKT 447 Query: 225 RETISHLCYTSHVSLQCPD 169 +E I+HL S + Q PD Sbjct: 448 KEQIAHL-KASFLQSQFPD 465 >AB083653-1|BAC76615.1| 837|Homo sapiens transcription factor ZHX2 protein. Length = 837 Score = 29.5 bits (63), Expect = 9.2 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = -1 Query: 405 VSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRS 226 VS + IT T+ PL T I + P PP +V+N + ++++ Sbjct: 388 VSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTPASDRKKT 447 Query: 225 RETISHLCYTSHVSLQCPD 169 +E I+HL S + Q PD Sbjct: 448 KEQIAHL-KASFLQSQFPD 465 >AB020661-1|BAA74877.2| 868|Homo sapiens KIAA0854 protein protein. Length = 868 Score = 29.5 bits (63), Expect = 9.2 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = -1 Query: 405 VSSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRS 226 VS + IT T+ PL T I + P PP +V+N + ++++ Sbjct: 419 VSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTPASDRKKT 478 Query: 225 RETISHLCYTSHVSLQCPD 169 +E I+HL S + Q PD Sbjct: 479 KEQIAHL-KASFLQSQFPD 496 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,137,869 Number of Sequences: 237096 Number of extensions: 2199900 Number of successful extensions: 5325 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5322 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6155099854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -