BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0390 (606 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 25 0.50 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 2.6 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 8.1 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 25.0 bits (52), Expect = 0.50 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +1 Query: 442 IGAPWCVRNVDHHDDLNL-ELILS*GLAHQTQNCSDER 552 +GA WC + +D++N+ E++ S L NC +R Sbjct: 11 LGAVWCEQYTTKYDNINVDEILASERLLKNYFNCIMDR 48 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/48 (18%), Positives = 22/48 (45%) Frame = -2 Query: 200 PAFSYRLLRVPTPSILSFRPRKFQSIIISCYTTFHFNTYFMITIYHVN 57 P F Y + + +F P K+ + C T + + +++ ++V+ Sbjct: 282 PEFRYLMKGIDRADSFNFNPHKWLLVNFDCSTMWLKDPSWLVNAFNVD 329 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = +3 Query: 225 RGESLYEVQRPGCAGIMCYVIKSMTEDDQGRDRR 326 RG+ +E+ G++C+ +K+ E ++ +R Sbjct: 391 RGDERFEITEEVVLGLVCFRLKASNEINEALLKR 424 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 52 INKRLNILPRAEFLQ 8 I +RL+ILP EFLQ Sbjct: 247 IFERLSILPVDEFLQ 261 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,138 Number of Sequences: 336 Number of extensions: 3197 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -