BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0390 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 27 8.9 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -2 Query: 92 NTYFMITIYH-VNGHK*KIKYFTSCRIPAAR 3 NTY+ + Y V+ ++ KY+++ RIPAAR Sbjct: 136 NTYWSLAYYRWVDNYQETKKYYSNYRIPAAR 166 >SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) Length = 681 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 113 CYTTFHFNTYFMITIYHVNGHK*-KIKYFTSCRIPAAR 3 C T + ++ ++YH ++KY TSC IP R Sbjct: 91 CIITTQNSEFYAASVYHPQTQSMMQLKYLTSCLIPVTR 128 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,895,321 Number of Sequences: 59808 Number of extensions: 395669 Number of successful extensions: 725 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -