BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0389 (523 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 1.2 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 25 1.5 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 25 2.0 DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. 24 3.6 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 23 4.7 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.4 bits (53), Expect = 1.2 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +1 Query: 178 AVHNPADD---SVVAEVPDMDSKDAQNALLTASNAFQTWKDTTAKERSRI 318 AV N ADD S + + D+ A +ALL A+N + +++ ++ SR+ Sbjct: 781 AVPNDADDDDESTMTTLQATDAHSAPHALLFAANKSKIKQESLVQQSSRM 830 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 280 TWKDTTAKERSRILRRWFDLCEKN 351 T+KDTT ++ ++RW D+ +N Sbjct: 326 TFKDTTGQQFYDNIKRWLDVVPEN 349 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 24.6 bits (51), Expect = 2.0 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = -1 Query: 379 LLSLLPNYRYFFHISQTTSLKYETVLLR*YLSMFETH*MRLVTRSVHLLNPYPAPLLL 206 +L L+ Y F I T S+ +++ TH M + RSV L+ PA LL+ Sbjct: 291 VLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMWIRSV-FLHYLPAMLLM 347 >DQ080861-1|AAY89507.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080860-1|AAY89506.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080859-1|AAY89505.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080858-1|AAY89504.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080857-1|AAY89503.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080856-1|AAY89502.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080855-1|AAY89501.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080854-1|AAY89500.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080853-1|AAY89499.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080852-1|AAY89498.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080851-1|AAY89497.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080850-1|AAY89496.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080849-1|AAY89495.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080848-1|AAY89494.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080847-1|AAY89493.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080846-1|AAY89492.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080845-1|AAY89491.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080844-1|AAY89490.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080843-1|AAY89489.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080842-1|AAY89488.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080841-1|AAY89487.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080840-1|AAY89486.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080839-1|AAY89485.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080838-1|AAY89484.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080837-1|AAY89483.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080836-1|AAY89482.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080835-1|AAY89481.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080834-1|AAY89480.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080833-1|AAY89479.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >DQ080832-1|AAY89478.1| 54|Anopheles gambiae GPRgr13 protein. Length = 54 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 403 QRVVSQIQLLSLLPNYRYFFHISQTTSL 320 Q++ S + LSL+P +FH + T L Sbjct: 2 QKIKSTVHRLSLIPGQDRYFHATINTFL 29 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 23.4 bits (48), Expect = 4.7 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 229 DSKDAQN-ALLTASNAFQTWKDTTAKERSRILRRWFD 336 D + QN ALL+ + F W + AK R R W D Sbjct: 37 DPRTNQNPALLSFAILFLRWHNVVAKRVRRQHRDWSD 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,500 Number of Sequences: 2352 Number of extensions: 11890 Number of successful extensions: 45 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -