BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0388 (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406 32 0.30 01_06_1664 - 38984545-38984615,38984706-38984802,38985362-389855... 29 2.8 08_02_0468 - 17505905-17506002,17506295-17506424,17506662-175067... 29 3.7 02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583,671... 29 3.7 02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 28 6.5 12_02_0772 - 23029703-23029715,23029835-23030463,23030637-230316... 27 8.7 11_03_0065 - 9522478-9525335,9525513-9526028,9526432-9527247,952... 27 8.7 11_03_0063 + 9515666-9516656,9517503-9518599 27 8.7 10_06_0007 + 9510385-9510535,9510860-9511433,9511553-9511565 27 8.7 10_05_0085 - 9005539-9005922,9006207-9006463,9006707-9006883,900... 27 8.7 09_04_0086 + 14445665-14446683,14448669-14448915 27 8.7 09_04_0085 + 14441123-14443507,14443731-14443787 27 8.7 08_02_0007 + 11208170-11210325,11210367-11210403 27 8.7 08_02_0004 + 11187587-11187923,11187939-11189861,11190195-11190391 27 8.7 08_02_0003 + 11180421-11180757,11180773-11185715 27 8.7 08_02_0002 + 11173365-11173512,11173528-11178470 27 8.7 08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651 27 8.7 07_01_0376 + 2815419-2815755,2815912-2817659 27 8.7 06_03_0452 + 20931484-20933872,20933950-20934074 27 8.7 06_01_0223 - 1709897-1709912,1710188-1712520 27 8.7 05_04_0185 - 18857229-18857638,18858347-18858424,18858758-18859931 27 8.7 04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962... 27 8.7 02_02_0337 - 9096588-9096603,9096879-9097927 27 8.7 01_01_0100 - 755894-756662,757086-757598,758718-761050 27 8.7 >12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406 Length = 351 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 303 RETARSTRAWGPYCRYTAARPKSWSDALRARTTTAACSPTNCWRRSRNWPTLDSTRILLR 482 R A R GP A +SW+ + A SP C+RR + W +L S+ R Sbjct: 237 RPHANVRRTNGPRSSPAAMAMESWARSASDAAADAGASP-GCFRRIKIWSSLSSSSSCSR 295 Query: 483 RSS 491 RS+ Sbjct: 296 RSA 298 >01_06_1664 - 38984545-38984615,38984706-38984802,38985362-38985523, 38985736-38985825,38986125-38986226,38986373-38986446, 38986587-38986615,38986766-38986989 Length = 282 Score = 29.1 bits (62), Expect = 2.8 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 2/89 (2%) Frame = +2 Query: 239 TVLNENYKGIVESMSIPAEIHERNGKKYASVGSILPIHCC--PPEELERRAESTHHYCGV 412 T L+ +K V M IH NGK+YA I I C ++ + S Sbjct: 162 TALDLYFKYNVTEMLASGGIHVSNGKQYALTDVIDAIKCAFGASPQIVCKKGSVEELRLC 221 Query: 413 FTDELLAPLEELAYVRLDENTAEKVFINR 499 F D+ L PL+ L +EN ++K + R Sbjct: 222 F-DKDLKPLDCLTTTATNENVSKKKYCPR 249 >08_02_0468 - 17505905-17506002,17506295-17506424,17506662-17506778, 17506881-17506959,17507546-17507654,17507857-17507969, 17510510-17510570,17511562-17511742,17512903-17512960, 17514292-17514497,17514582-17514671,17514752-17514813, 17514911-17514979,17515330-17515334,17516282-17516454 Length = 516 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -1 Query: 595 RAGDVPVRRLEGRRAPPLRQVPVA*-HYQYALGSVYEDLLSSILVESNVGQFLERR 431 +A +P+R R P ++ A HY Y+L S+YE +L I+ S ++RR Sbjct: 157 KAATMPIRSRGVRWNKPRYELTAALFHYSYSLQSLYESILQEIM-NSAPSNSIQRR 211 >02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583, 6717646-6717725,6717802-6717903,6717982-6718471, 6718796-6719171,6720320-6720379,6720887-6721056, 6721287-6721340,6721384-6721523,6722362-6722511, 6722582-6722642,6722705-6722784,6722933-6723034, 6723111-6723612,6724401-6724776,6725419-6725493, 6726058-6726198,6726264-6726282 Length = 1065 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = -2 Query: 348 IGSMDPTLAYFLPFLSCISAGILIDSTMPL*FSFSTVRLDIAVFLENKSEN 196 +G M + +F F +C G+L +S++ F T+R+D+ + + ++N Sbjct: 524 LGMMRWGVVFFFSFSNCSICGLLYESSVKHIVFFCTIRVDLVLHTFDGNKN 574 >02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 Length = 933 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ + ++ ++A EL Y+ L +++ Sbjct: 146 EELKRAGSNPHNFANIVSNIIIAEDPELGYITLQNERLKEI 186 >12_02_0772 - 23029703-23029715,23029835-23030463,23030637-23031673, 23031830-23032166 Length = 671 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 496 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 536 >11_03_0065 - 9522478-9525335,9525513-9526028,9526432-9527247, 9527440-9527767 Length = 1505 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 401 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 441 >11_03_0063 + 9515666-9516656,9517503-9518599 Length = 695 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 178 EELKRAGSNPHNFANVISNIIIAEDPELCYTTLQNERLKEI 218 >10_06_0007 + 9510385-9510535,9510860-9511433,9511553-9511565 Length = 245 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 70 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 110 >10_05_0085 - 9005539-9005922,9006207-9006463,9006707-9006883, 9007349-9007490,9007814-9007904,9009024-9010942 Length = 989 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 468 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 508 >09_04_0086 + 14445665-14446683,14448669-14448915 Length = 421 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 178 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 218 >09_04_0085 + 14441123-14443507,14443731-14443787 Length = 813 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 606 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 646 >08_02_0007 + 11208170-11210325,11210367-11210403 Length = 730 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 593 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 633 >08_02_0004 + 11187587-11187923,11187939-11189861,11190195-11190391 Length = 818 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 601 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 641 >08_02_0003 + 11180421-11180757,11180773-11185715 Length = 1759 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 591 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 631 >08_02_0002 + 11173365-11173512,11173528-11178470 Length = 1696 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 528 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 568 >08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651 Length = 642 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 435 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 475 >07_01_0376 + 2815419-2815755,2815912-2817659 Length = 694 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 554 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 594 >06_03_0452 + 20931484-20933872,20933950-20934074 Length = 837 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKVFINR-AKRILIVSSDGH 535 EELER S +H+ G D +A L +L V+L +N+ E + K L+ + + H Sbjct: 320 EELERLFLSNNHFTGSIPDS-VALLPKLTNVQLFQNSFEGILPQELGKHSLLFNLETH 376 >06_01_0223 - 1709897-1709912,1710188-1712520 Length = 782 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 606 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 646 >05_04_0185 - 18857229-18857638,18858347-18858424,18858758-18859931 Length = 553 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 239 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 279 >04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305, 9625520-9626032,9626801-9629153 Length = 1342 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 606 EELKRAGSNLHNFANVISNIIIAEDPELGYTTLQNERLKEI 646 >02_02_0337 - 9096588-9096603,9096879-9097927 Length = 354 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 178 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 218 >01_01_0100 - 755894-756662,757086-757598,758718-761050 Length = 1204 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 365 EELERRAESTHHYCGVFTDELLAPLEELAYVRLDENTAEKV 487 EEL+R + H++ V ++ ++A EL Y L +++ Sbjct: 606 EELKRAGSNPHNFANVISNIIIAEDPELGYTTLQNERLKEI 646 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,076,120 Number of Sequences: 37544 Number of extensions: 254485 Number of successful extensions: 941 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -