BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0387 (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0752 - 10922456-10922644,10922719-10922796,10922888-109230... 30 1.2 07_01_0453 + 3420727-3420800,3421666-3421792,3422348-3422431,342... 29 3.7 >03_02_0752 - 10922456-10922644,10922719-10922796,10922888-10923016, 10923105-10923152,10923243-10923333,10923517-10923648, 10923869-10924086,10925121-10925271,10925360-10926009, 10926715-10926786,10926938-10926985,10927105-10927242, 10927750-10927756,10928064-10928212 Length = 699 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/61 (29%), Positives = 23/61 (37%) Frame = +1 Query: 394 EEKCEYGCACKIGYLRDENGTCIPQDKCPTVPCPVNEYFTNCAKGMCRQENCTELGKLSE 573 ++ C CAC ENGTC + + C +CAK CR C E Sbjct: 457 QQMCGKDCACV------ENGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAASRE 510 Query: 574 C 576 C Sbjct: 511 C 511 >07_01_0453 + 3420727-3420800,3421666-3421792,3422348-3422431, 3422550-3422644,3423063-3423154,3423326-3423379, 3424221-3424273,3424472-3424539,3424777-3424852, 3425159-3425242,3425793-3425941,3426375-3426492, 3426583-3426699,3426950-3427170,3427503-3427536, 3427585-3427685,3427832-3427943,3428379-3428504, 3428579-3428716,3428808-3428858,3428938-3429050, 3430253-3430318,3430582-3430729,3430826-3430930, 3431017-3431118,3431495-3431567,3431647-3431813, 3431906-3432028 Length = 956 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 473 LSCGIQVPFSSLRYPILQAHPYSHFSSST 387 LSC PFS+L +P L + + HF +T Sbjct: 483 LSCSALWPFSTLGWPDLSSEDFKHFYPAT 511 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,762,246 Number of Sequences: 37544 Number of extensions: 353399 Number of successful extensions: 786 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -